KEGG   Spirosoma montaniterrae: AWR27_04185Help
Entry
AWR27_04185       CDS       T04702                                 

Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
smon  Spirosoma montaniterrae
Pathway
smon00020  Citrate cycle (TCA cycle)
smon00620  Pyruvate metabolism
smon01100  Metabolic pathways
smon01110  Biosynthesis of secondary metabolites
smon01120  Microbial metabolism in diverse environments
smon01200  Carbon metabolism
Module
smon_M00009  Citrate cycle (TCA cycle, Krebs cycle)
smon_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:smon00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AWR27_04185
   00620 Pyruvate metabolism
    AWR27_04185
Enzymes [BR:smon01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     AWR27_04185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo nlz1
Motif
Other DBs
NCBI-ProteinID: AQG82304
UniProt: A0A1P9X3T4
Position
complement(975173..976705)
Genome map
AA seq 510 aa AA seqDB search
MAKHTNTTEKGPDVLLIGAGIMSATLGVLLKELEPSLTIDIYERLDKAAAESSDAWNNAG
TGHSAFCELNYTPEREDGTIETPKAVKIAESFEQSKQFWAHLVENGFLNDAPGFIRSIPH
MSFVWGDENVRYLHKRYDALQQNHLFHGMQYSEDPAHLADWMPLVMEGRDPAQPVAATRM
DIGTDVNFGALTRCMFAKLQEMPGVTMHFGYDVRDLWRSKSLGGWKVRVENLTTGATRDV
QAGFVFIGAGGGSLRLLEKSDIPESRGYGGFPVGGQWLKCTNRDVVERHHAKVYGKASVG
APPMSVPHLDTRMIDGKQELLFGPYAGFSTKFLKHGSYLDLPKSIQLSNMAPMLMAGLHN
IPLTKYLIQQVMQSPEDRLAALKEYFPEAQMDDWELEIAGQRVQVIKKDDEEGGVLEFGT
EVVSAADGSIAALLGASPGASTAVSIMLDLMTKCFPTQIASPDWQQKLREMIPSYGQSLA
KNAELTRQLREQTSRILGLTMDEQTPEVTR
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagcatacaaatacaactgaaaaaggccccgacgttctgctgattggcgcgggt
attatgagtgctacgctcggcgtactgttaaaagaactggaaccgtcgctcacgattgat
atttacgaacggctcgacaaggcagccgccgaaagctccgacgcctggaataacgcaggc
accggccattcggccttctgcgaactcaactacacccccgaacgcgaagacggcactatt
gaaacacctaaggccgtcaaaattgccgaatcgtttgagcagtcgaagcagttctgggcg
catttggttgaaaacgggtttctgaatgatgcaccgggctttatccggtcgattccgcac
atgagtttcgtgtggggcgatgagaatgtgcggtatttgcacaaacgctacgacgcgctc
cagcagaaccacctgtttcatgggatgcagtattccgaagacccggcacatctcgccgac
tggatgccgctcgtaatggaaggccgcgacccggctcagcccgtagcggccacccgcatg
gacattggcaccgacgtaaattttggcgcactcacgcgctgcatgttcgccaaactgcaa
gagatgccgggcgtaacgatgcactttggctacgacgtgcgcgacctctggcggtcgaag
tcgctcggcggctggaaagttcgggtcgaaaacctaacgaccggcgcaacccgcgacgta
caagcgggatttgtattcatcggggctggtggcggttcgctgcggctgctcgaaaaatca
gacattcccgaaagccggggctatggtggtttcccggtgggcgggcagtggctcaaatgc
accaaccgcgacgtggtcgaacggcaccatgccaaagtctacggcaaagcgtcggtaggt
gccccacccatgtcggtgccgcacttagacacccgcatgatcgatggtaagcaggagtta
ctgttcggtccctacgccgggttctcgaccaaattcctgaaacacggttcgtatcttgat
ttgccgaagtcgatacagttaagcaacatggctccgatgctgatggctggtttgcacaat
attccgctgacgaagtacctgattcagcaggtgatgcaatcgcccgaagaccggctggcg
gctttaaaagagtatttccccgaagcgcagatggacgactgggaactggaaattgccggg
cagcgggtgcaggtcatcaaaaaagacgacgaagagggcggtgtgctggaatttggcaca
gaggtagtgagtgctgctgacggcagcattgccgcgctgctgggtgcttcgccgggtgcc
tccactgccgtatcgatcatgctcgacctgatgaccaagtgtttccccacgcaaatagcc
tcgcccgactggcagcagaaactacgcgaaatgattccgagttacgggcaatcgctggcg
aaaaacgccgaactgacccgccaactccgcgagcaaaccagccgcattcttggcttaacg
atggatgaacaaacgcccgaagtaacgcggtaa

DBGET integrated database retrieval system