KEGG   Spirosoma montaniterrae: AWR27_18630Help
Entry
AWR27_18630       CDS       T04702                                 

Definition
(GenBank) nuclease PIN
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
smon  Spirosoma montaniterrae
Brite
KEGG Orthology (KO) [BR:smon00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    AWR27_18630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 PTPS_related
Motif
Other DBs
NCBI-ProteinID: AQG81157
UniProt: A0A1P9X0J1
Position
complement(4371552..4372973)
Genome map
AA seq 473 aa AA seqDB search
MFGLETDVFILLFISLFAACAFEFVNGFHDTANAVATVIYTNSLKPTVAVVWSGICNFAG
VLLGGIGVAMGIVNLLPVELLVDQNVYHSIAMVMALLLSAIIWNVGTWYFGLPSSSSHTL
IGSILGVGLAFSTLPDNTEGAAVNWEKAIETGQALLLSPLLGFSLVIVIMFLIRRLVPEE
TKDQLFKEPKKNAPPPSWIRGILIATCSMVSFFHGSNDGQKGVGLVMLILIGIVPFQFAV
KSDIDPRLMNANVAAVEQTLGRVNAATLSTANQDRLLKTRAELNDLKQLLAQPLVDGKIP
QEKRLDVRRDLLLINSNARKIAEDEGANLSAADLKTLEANLDEKGGLRRYTDYAPTWVIL
MIALSLGLGTMIGWRRIVVTVGEKIGKQHLTYAQGASAELTAAIMIAVSSWKHLPVSTTH
ILSSGIAGSMVANKGIKNLQAGTVRNIALAWVLTLPVSILLSFTLYILFRWLI
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgtttggtttagaaacggatgtttttattctgctgtttatcagcttgtttgctgcctgt
gcttttgaatttgtcaatggttttcacgatacggccaatgctgtagctaccgttatctac
accaactcgctgaagccgaccgtggccgttgtgtggtcgggcatctgcaactttgcgggc
gtactgctgggtggtatcggtgtagcaatgggtattgtcaacctgctgcccgttgaactg
ctcgtcgatcagaatgtgtaccatagcattgcgatggtaatggctctgctgctcagtgct
atcatctggaacgtgggcacctggtactttggcctgccaagttcgagttcgcacacgctg
attggctccattctgggcgttggtctggccttctctaccctgcccgacaataccgaaggc
gcagccgtgaactgggagaaagccatcgaaaccggacaggctctgctgctatcgcccctg
ttgggtttcagcttagtaatcgtcattatgtttctgattcggcggctggtgcccgaagaa
accaaagatcagctttttaaggaacccaaaaaaaatgcaccgccaccgtcgtggattcgc
ggcattctgattgctacctgctcaatggtgagcttcttccacggcagcaacgacgggcaa
aagggcgtgggattggttatgctgattctgattggtatcgtgccgtttcagttcgccgtc
aagtctgacatcgacccccgtttgatgaacgccaacgttgctgcggttgagcaaacgctg
ggccgggtcaatgccgctacgctctccacggccaatcaggaccgcttacttaaaacacga
gccgaactgaatgacctgaaacaactactggcacagccgcttgttgacggaaaaattccg
caggaaaaacgtttagacgtccggcgcgacctgttgctcatcaacagcaacgccagaaag
attgccgaggatgaaggcgcaaacctcagtgcggctgacctgaaaacgctggaagccaac
ttagatgaaaaaggtggcctacgccgatataccgactatgcgccgacctgggtaattctg
atgattgccctatcgctgggtttgggcaccatgattggctggcgtcggattgtagtaacg
gtgggagaaaaaattggtaagcagcacctcacctacgcgcagggtgcctctgccgaacta
acagccgctataatgattgctgtttcgtcgtggaagcacctgcccgttagcaccacccac
attctgtcgtcgggtattgcgggtagtatggtggcaaacaaaggcattaaaaacttgcag
gcgggcactgtgcgcaatattgctcttgcctgggtgctaacgctgccagtttctattttg
ctgtcgtttaccctctatatcctcttccgctggctgatttga

DBGET integrated database retrieval system