KEGG   Sordaria macrospora: SMAC_00040Help
Entry
SMAC_00040        CDS       T01610                                 

Definition
(RefSeq) uncharacterized protein
  KO
K01426  amidase [EC:3.5.1.4]
Organism
smp  Sordaria macrospora
Pathway
smp00330  Arginine and proline metabolism
smp00360  Phenylalanine metabolism
smp00380  Tryptophan metabolism
smp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    SMAC_00040
   00360 Phenylalanine metabolism
    SMAC_00040
   00380 Tryptophan metabolism
    SMAC_00040
Enzymes [BR:smp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     SMAC_00040
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-GeneID: 10809097
NCBI-ProteinID: XP_003351499
UniProt: F7VJZ7
Position
Unknown
AA seq 584 aa AA seqDB search
MPVLKSWLAAATAIGMCLGAALPTPSAEDIKLLKEKSVLSDILFPVLPCGKFKLEEATID
DMQAAMNAGTLTSVQLVGCYVLRTFQTDLYINSLLQYNPDALAIAAQMDAERAAGKVRGP
LHGIPFTVKENIATKDQMETTAGSWALLGSVAPRDAHVVAKLREAGAVLFGKATLSEWAD
MRSNDYSEGYSARGGQCRSAYNLTVNPGGSSSGSAVGVAANTIAFSLGTETDGSVINPAM
RNNIVGFKPTVGLTSRAGVIPESEHQDSVGTFGRTVADAVYALDAIYGVDERDEYTLAQD
GKTPEDGYASYLTTKDALKDATFGIPWNSFWRYADPEQLRQLTALIQLIEDAGATIINGT
EITDYERIVSPNGWDWDYGTNRGYPNESEYTVVKVDFYNNIKTYLSELENTNIRSLEDIV
QFNYDNDGTEGGHPWPQGHPAFRSGQDGFLASLATKGIKDETYYQALNFTQSSTRNGIDD
ALTYKGKKLSGLFVPPDVAQAPQIAAQAGYPMITLPAGTHSASGMGIGLGIMQTAYGEAE
LVKWGSAIEDLQKSTDTPHKRTLPQWRDFLKRNIPVYNVYEGSD
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtcctcaagagttggctagccgccgctacggcgattggcatgtgcctgggtgct
gcccttcccactccttccgccgaggacatcaagctcctcaaggagaagagcgtgctcagc
gatatcctctttcctgtcctcccctgcggcaagttcaagctcgaggaggccaccatcgat
gatatgcaggctgccatgaacgccggcaccctcacctcggtccagctcgtcggttgctat
gtcctccgcactttccagactgatctctacatcaactccctcctccagtacaaccctgat
gctctggccatcgctgctcagatggacgctgagcgtgctgccggcaaggtccgcggtcct
cttcatggtattcccttcaccgtcaaggagaacattgccaccaaggaccagatggaaacc
actgctggctcatgggctcttctcggcagcgttgcccctcgtgatgcccacgtcgtcgcc
aagctccgtgaggccggtgccgttctcttcggcaaggctaccctctccgagtgggccgat
atgcgcagcaacgactactccgagggttactctgcccgcggtggtcagtgccgctctgct
tacaacctgaccgtcaaccccggcggttcctcctccggtagcgccgtgggtgtcgctgcc
aacaccattgccttctccctcggaaccgagaccgacggctccgtcatcaaccctgctatg
cgcaacaacattgtcggcttcaagcccaccgttggtcttacttcccgtgccggtgtcatt
cccgagagcgagcaccaagattccgtcggtacttttggccgtactgtcgctgatgctgtc
tatgctcttgatgccatctacggtgttgatgagcgcgacgagtacaccctcgcccaggac
ggcaagacccctgaggacggctacgcctcgtaccttaccaccaaggatgccctcaaggac
gccaccttcggtattccctggaacagcttctggcgctacgccgaccccgagcagctccgc
cagttgaccgcccttattcagctcatcgaggatgctggtgccaccattatcaacggcacc
gagatcaccgactacgagaggatcgtcagccccaatggctgggactgggactatggcacc
aaccgcggctaccctaacgagtccgagtacaccgtcgtcaaggttgacttctacaacaac
atcaagacctacctgtccgagctcgagaacaccaacatccgctctctcgaggacatcgtc
cagttcaactacgacaacgacggcactgagggtggtcacccctggccccagggtcacccc
gccttccgctctggtcaggatggcttcctcgcttccctcgccaccaagggtatcaaggac
gagacctactaccaggccctcaacttcacccagtcctctactcgcaacggcattgatgac
gcccttacttacaagggcaagaagctctccggcctctttgtcccccctgatgtcgctcag
gctccccagattgctgctcaggccggttaccccatgatcacccttcccgccggcacccac
tccgcaagcggtatgggtatcggtctcggcatcatgcagactgcctacggtgaggccgag
ctcgtcaagtggggttccgccattgaggacctccagaagtccaccgacacgcctcataag
cgcacccttccccagtggagggatttcctcaagaggaacattcccgtctacaacgtttac
gagggttccgattaa

DBGET integrated database retrieval system