KEGG   Sordaria macrospora: SMAC_00940Help
Entry
SMAC_00940        CDS       T01610                                 

Definition
(RefSeq) uncharacterized protein
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
smp  Sordaria macrospora
Pathway
smp00350  Tyrosine metabolism
smp00360  Phenylalanine metabolism
smp00380  Tryptophan metabolism
smp01100  Metabolic pathways
smp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:smp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    SMAC_00940
   00360 Phenylalanine metabolism
    SMAC_00940
   00380 Tryptophan metabolism
    SMAC_00940
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    SMAC_00940
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:smp04147]
    SMAC_00940
Enzymes [BR:smp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     SMAC_00940
    4.1.1.105  L-tryptophan decarboxylase
     SMAC_00940
Exosome [BR:smp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SMAC_00940
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Bac_DnaA_C
Motif
Other DBs
NCBI-GeneID: 10807560
NCBI-ProteinID: XP_003350051
UniProt: F7VNI6
Position
Unknown
AA seq 508 aa AA seqDB search
MDSRGFREAAATAIDEIAGYYDNLDERDVVSTVEPGYLRKLLPSEAPVEGEAWTDIQKDI
EGKILPGITHWQHPGFHAFFPCATSFPSILGELYSAALSGACFNWICSPAVTELETIVLD
WLAKVLGLPECYLSTGPTRGGGVIQGSASEAVLTAMVAARDKYLRETVPLEQFPDGSEAR
EDAIAHKRSKMVALATTATHSSTKKAAIILGVRFHTTAVHADTGYSLTGPVLAKTLADLR
ARGLEPFFMTATLGTTDTCAVDDFAGIVSTLKSDPVYPAGTPGELWVHIDAAYAGSALVL
PSVQQDVSISLIENFHSFDMNMHKWLLTNFDASCLYVRDRNWFIQALTINQAVYGNKASE
GGLVTDYREWQIPLGRRFRSLKVWFVLRSYGVKGLQEYISRTIKLGEEFADQLKSRPDLF
EILTGPSFALTVFRVAGKEQGKSEEELNTLTKAVCEKINASGRMWVTSTVLDGRFAIRMV
TSVRTTEKVHVDRAWKILVDAAEEVVKA
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atggattctcggggtttccgtgaggccgctgccacggccattgacgagattgccggctac
tatgacaaccttgacgagcgggatgtcgtgtccaccgtagagcctggttacctgcgaaaa
ctcttgccctccgaggccccagtagaaggcgaggcctggactgatattcagaaagatatc
gagggcaagatcctccccggtatcactcactggcaacaccccggcttccacgccttcttc
ccctgcgccacctccttcccctccatcctcggtgagctctacagcgccgccctctccggc
gcctgcttcaactggatctgctctccagccgtgaccgagctcgagaccatcgtgctcgac
tggctagccaaggtccttggccttcccgaatgctacctctccaccggtcccacgcggggc
ggcggcgtcatccagggctccgcctccgaggccgttctgacggccatggtcgccgcccgc
gacaagtacctgcgcgagacggttccccttgagcagttccccgatggctccgaggcgcgc
gaggacgccatcgcccacaagcgaagcaagatggtggcgctcgccacgacggccacccat
agctctaccaagaaggctgccatcattttgggagtgcggtttcacaccaccgccgtccac
gccgatacgggatactcgcttacgggtcccgtgctggccaagacgctcgctgacctgcgc
gcccgcggcctcgagcccttcttcatgaccgccaccttgggaacgaccgacacctgcgcg
gtcgacgacttcgccggcatcgtgtcgacgctcaagtccgaccccgtgtaccctgccggc
actcccggcgagctgtgggtgcacatcgacgcggcgtacgccggctccgccctcgttctc
ccctcggtccagcaagatgtctccatctcgctcatcgagaacttccactcgttcgacatg
aacatgcacaagtggctcctgaccaacttcgacgcctcgtgcctttacgtgcgcgacagg
aactggttcatccaggccttgaccataaaccaggccgtgtacggcaacaaggcgtccgag
ggcgggctggtaacggactaccgcgagtggcagatcccgctcggccgccgcttccggtcg
ctcaaggtctggttcgtgctccggtcgtatggtgtcaagggcctgcaggagtacatcagc
cgcaccatcaagctgggcgaggagtttgccgatcagctcaagtcgaggccggatctgttt
gagatcttgaccggcccgagctttgccctcactgtgttcagggtcgctggcaaggagcag
ggtaagagcgaggaggagctgaacacgcttaccaaggctgtgtgcgagaagatcaacgct
tctggcaggatgtgggtgaccagcacggtgttggatggcaggttcgccattcgcatggtg
actagtgtgaggacgactgagaaggtgcatgttgaccgggcatggaagattctggtcgac
gccgcggaggaggtcgtcaaggcttag

DBGET integrated database retrieval system