KEGG   Sordaria macrospora: SMAC_01184Help
Entry
SMAC_01184        CDS       T01610                                 

Definition
(RefSeq) uncharacterized protein
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
smp  Sordaria macrospora
Pathway
smp00600  Sphingolipid metabolism
smp01100  Metabolic pathways
Module
smp_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:smp00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    SMAC_01184
Enzymes [BR:smp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     SMAC_01184
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat DUF809
Motif
Other DBs
NCBI-GeneID: 10807796
NCBI-ProteinID: XP_003350289
UniProt: F7VMI0
Position
Unknown
AA seq 565 aa AA seqDB search
MGDVRQLQEEHAAAMAKTSAQEPSIQAVTSQATATSSASGKNVDILELPAVTLTCEKGEL
VIQVTQMPDKEEEAQTSTGFLNYIPLDGLDGILTPFFPSSTVTPPRRLPPGSVPFYNILW
AYITPDRNYLRIDFAEETSPKKHQLIVRQLEFPLPSAPSQAPERESLLSPTILSPSAATL
DAFVSRLLDLAYPAPIQRRKRAWVLVNPQAGPGGADKIFEKEVRPIFEAARMPLTIIRTT
YSGEAVTLSQDLDISQYDIAVPCSGDGLPHEVFNGLSKRSDARRALARVAVCHIPCGSGN
AMSCNLYGTHRPSLAALAIVKGVPTKLDLCSVTLQDGERLTSFLSQAYGMIADLDITTEH
LRWMGAARFTYGFLTLAIRKKTYPCDVAMKVEVDGKGEIKGHYARGVRSTEGEVENGEAS
GDGLGEEDGAGEEGEEGGAGLKMAYMAPDANFFSAALANDGLLDLITTDGDISLWKNINM
QLSVESGHFFDNPLVSYRKVSAFRLTPRYQDPNGVISIDGEARPFAPFQVEVHKGLGLTL
SKRGVFEAPGPHGWDKVSTTERLMA
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgggggacgtccgacaattacaggaggaacacgcggcggccatggcaaagacgagcgca
caagagccgtctatccaggccgtgacatcgcaagccactgcaacttcttctgcttccgga
aagaatgtcgatattctcgaactgcccgccgtcacactcacctgcgagaaaggtgaattg
gtaattcaagtcacacaaatgcccgataaggaagaagaggcccagacctcaaccggattc
ctaaactacatccctctcgacggtctcgacggcatactaaccccgttcttcccctcctcc
acagtcacccctccgcgtcgtcttcctccggggtccgtcccgttctacaacatcctctgg
gcctacatcaccccagaccgcaactacctccgcatcgacttcgccgaagagacatcaccc
aagaagcatcaacttatcgtccgccaactcgagttccctctcccctcagctccctcccaa
gctcccgagcgcgaatcacttttgtcccccaccattctatcgccctcggccgccacgctg
gacgccttcgtctcccgccttctcgacctcgcctaccccgcgcccatccaacgccgaaag
cgcgcctgggttctcgtcaacccccaggctggcccaggcggcgctgacaagattttcgaa
aaggaagtccgtcccatcttcgaagcggcccgcatgccgctcaccatcatccgcaccact
tactcgggtgaagccgtcaccctgtcccaagacctcgacatatcccagtacgacatcgca
gtcccttgctccggcgacggcctaccacacgaagttttcaatggtctttccaagagatcc
gacgcccgccgtgctttggcgagggtagcagtgtgccacatcccctgcggctccggaaac
gccatgtcctgcaacttgtacggcacgcaccgcccttcgctggcggcgctggcgattgtg
aagggcgtgccgacgaagctggacctgtgcagcgtcacgttgcaggatggagagcgcctg
acgagcttcttgagtcaggcgtacggcatgattgctgatctggatatcacgacggaacat
ctgaggtggatgggggcggcgaggttcacgtacgggttcttgacgctggccatcaggaag
aagacgtatccatgtgatgtggcgatgaaggtggaggtggatgggaagggggagattaag
gggcattatgctaggggggtgaggagcacggaaggggaagttgagaacggggaagctagc
ggggatgggcttggggaagaggatggtgcaggagaggagggagaagaggggggtgccggg
cttaagatggcctacatggccccagacgccaacttcttctccgccgccctcgccaacgac
ggcttgctagatctgatcaccaccgacggcgacatttctctctggaagaacatcaacatg
caactttctgtcgaatctggtcacttcttcgataaccccctggtttcttaccgcaaagtg
tccgctttccggttgacgccccggtaccaggacccgaacggcgtgattagcatcgatggc
gaggcgagaccgtttgcgccgttccaggtggaggtgcataagggtcttggactgactctc
agcaagaggggcgtgtttgaggcgccggggccgcatgggtgggataaagtttcgacgacg
gagaggttgatggcctaa

DBGET integrated database retrieval system