KEGG   Sordaria macrospora: SMAC_01325Help
Entry
SMAC_01325        CDS       T01610                                 

Definition
(RefSeq) uncharacterized protein
Organism
smp  Sordaria macrospora
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_35 BetaGal_dom2 BetaGal_dom4_5 BetaGal_dom3
Motif
Other DBs
NCBI-GeneID: 10810122
NCBI-ProteinID: XP_003352491
UniProt: F7VQH6
Position
Unknown
AA seq 958 aa AA seqDB search
MRLLSVLSAVSVTAGLGYAETLKPQTLLQDIVTFDNSSLFINGERLMIFSGEVHPFRLPV
PSLWLDIFQKVKALGLNTPVNKAADAEASGGGFPGWLQRIKGHLRTADPEFLSATDNYIA
NIDKLIAKYQITNGGPIILYQPENEYTGAAAGIKFPDPDYMQYVIDQARDAGIVLPMMSN
DASWKGGHNLPCSGKGEVDIYGHDGYPLGFDCKNPTTWPLGGLITQYRTQHLNFSASTPY
TVPEFQGGSFDPWGGYGFDQCGQLINHEQVRVFYKNMFASGVTIFNLYMIFGGTNWGNLG
HPGGYTSYDYAAAIAEDRTVSREKYSELKLEASFLKVSPGYLTATPDISNKTGVYSPNID
ITVTSLVNYTPKGGSFYVVRHTDYQTLASTPYTLSLPTSAGNLSIPILGSSLTLGRRDSK
VHVTDYPVGDHKLIYSTAEIFTWQKFSDRTVLVVYGGEGETHELAIADVFKWKSTGPPVQ
VKTVKKDARKSFTAVQWKTNSERRIFKAGNLHIYLLDRNSAYNYWAPQIADTSSSLIVNG
GYLIRSASINGASLSLQADFNTTTTLELIGVPRGVSKLQINGETTKYRIDSEGNYIVKIS
YKVPTLFLPDLSKAKWSYIDSLPEIQPDYDDSAWPSANLKSTNNTYVGPLKTPASLYASD
YGFHTGALLFRGHFTATGAETKLYISTIGGSAFGSSVWLNNSFVGSWRGSGAASVHNDTY
NLPSPLVAGENYVFTMLVDNMGLDEDWTVGDDTMKRPRGILDYSLFTSTNISVPKSDITW
KLTGNLGGEQYRDKARGPLNEGGLYVERQGYHLPSPPASASSSSSIPFTGISQPGVAFYT
TSFPLSLPSSEYDIPLSFVLDNPTSFESGTEYRAWLYVNGFQYGRYVSHIGPQTSFPVPE
GILNYNGENWVGVVVWATGKKGAKVPGLKLEAGTPVRTGRKEVEVVDGGGWERRTGAY
NT seq 2877 nt NT seq  +upstreamnt  +downstreamnt
atgaggttgctctccgtcctgtcagccgtgtccgtaacggcaggcctaggatacgccgag
accttgaagcctcagacacttcttcaggatatcgtcaccttcgataactcgtcactcttc
atcaatggcgagcggctcatgatctttagcggcgaggtccatcccttccgtttgcctgtt
ccatcgctatggctggacatcttccagaaggtcaaggctctcggtctcaatactcctgtt
aacaaggctgcagatgccgaggcgtccggcggcggcttcccaggttggctccagagaatc
aagggacacctaaggaccgcagacccagaattcctgagtgctaccgataactatatcgcc
aacatcgacaagctcatagccaagtaccagattaccaacggtggccccattatcctctac
cagcccgagaacgagtataccggtgcagctgcaggaatcaaattccctgaccctgattac
atgcaatatgtgattgaccaggcacgagatgctggtatcgtgctccctatgatgagtaac
gatgcttcatggaagggtggtcacaaccttccttgctcaggaaaaggagaggttgatatt
tacgggcacgatgggtatccattgggtttcgactgcaagaatcccacaacatggcctctg
ggtggtttgataacgcagtaccgtacccagcacctgaattttagtgcttctactccgtac
actgtaccggagtttcagggaggcagttttgatccatggggcggatatggctttgaccag
tgcgggcaactcattaatcatgagcaagtccgtgtcttttacaagaacatgtttgcttct
ggcgtcaccatctttaacctttatatgatcttcggaggcaccaactggggtaacttggga
catccgggcggctacacctcatacgactatgctgctgccatagccgaggaccgtaccgtt
tctcgcgagaagtattcggagttgaaattggaagccagcttcctcaaggtttcacctgga
tatctcacagctacacccgacatcagcaacaagacgggcgtgtatagccctaacatagac
attactgtgacttccctcgtcaactatacacccaagggaggctcgttctacgttgttcga
cacactgattaccagacacttgcttcaaccccatacacactctcgctgccgacctcagct
gggaacctgagcattcccatccttggtagttccctcacactaggcaggcgagacagcaaa
gttcacgtaacggattatcccgtcggcgaccacaagttgatctactcgacagctgagatc
ttcacttggcagaagttcagcgatagaacggtattggtcgtgtatggtggtgaaggcgaa
acccatgagctggcaattgccgacgtattcaagtggaagtcgacaggtccaccagtacag
gtgaagacggtcaagaaggatgcgaggaaatcgttcaccgccgtgcagtggaagacgaac
tcagagaggaggatcttcaaggcaggaaatctgcacatctaccttcttgatcgtaactct
gcctacaactactgggcaccccaaatcgcagatacatcatcctccttgattgttaatggt
ggatatctcatcagatccgcttccatcaatggcgcttctctgtcacttcaagccgatttc
aacaccacaaccacactcgaactcattggtgtgcctcgtggtgtttccaagctacaaatc
aacggcgagactaccaaatatcgaatagactccgaaggcaactacatcgtcaagatcagc
tacaaggtcccaacccttttcctccccgacctttccaaggccaaatggtcctacatcgac
tccctacccgagatccaacccgactacgatgactcagcctggccctctgccaacttgaaa
tccaccaataacacctacgtcgggcccctcaagaccccggcctccctctacgcctccgac
tacggcttccacacaggtgccttgctcttccgtggtcacttcaccgccaccggtgccgaa
acaaagctttacatctccactatcggcggcagcgccttcggctcctcggtctggctcaac
aactccttcgtaggcagctggcgcggaagcggcgcggcctcggtgcacaacgacacttac
aacctcccgtctccactcgttgcaggcgagaattacgttttcaccatgctggtcgacaac
atgggtctggacgaggattggacagtcggcgacgacaccatgaagcgtccgcggggcatc
ctggactactccctcttcacctccaccaacatttcagtccccaaatccgacatcacctgg
aaactcaccggcaacctaggcggcgaacaataccgcgataaagcccgcggtcctctaaac
gaaggcggtctctacgtcgagagacaaggttaccacctgccttcacctcccgcctccgct
tcttcgtccagctctatcccattcacaggcatctcccaaccaggcgtagccttctacacc
acctcattccccctttccctcccctcctctgagtatgacatcccactgagcttcgtcctc
gacaaccctacctcattcgagtcaggaacagaatacagagcctggctgtacgtcaacggt
ttccaatacggccggtacgtaagtcatattggtccgcagaccagtttccctgtgcctgag
gggatattgaattataatggtgagaattgggtgggagtggtggtttgggctacggggaag
aagggggcgaaggtgccggggttgaagttggaggccgggacgccggttaggacggggagg
aaagaggtggaggttgtggatgggggtggttgggaaagaaggaccggcgcttattga

DBGET integrated database retrieval system