KEGG   Sordaria macrospora: SMAC_01341Help
Entry
SMAC_01341        CDS       T01610                                 

Definition
(RefSeq) uncharacterized protein
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
smp  Sordaria macrospora
Pathway
smp00970  Aminoacyl-tRNA biosynthesis
smp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smp00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SMAC_01341
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:smp03029]
    SMAC_01341
Enzymes [BR:smp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     SMAC_01341
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     SMAC_01341
Mitochondrial biogenesis [BR:smp03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    SMAC_01341
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidase DUF3693
Motif
Other DBs
NCBI-GeneID: 10810135
NCBI-ProteinID: XP_024511135
Position
Unknown
AA seq 537 aa AA seqDB search
MSARIGRLRGLCLRHVSSTRQTSPIQRRFLNQFISRVQQDDLPVLEQRQFRLAVKDNIAT
VSPNPEEETPLTTTCGSNFLANYRSPFEATIVTQLRSRGALLVGKTNLDEFGMGSHSVHT
AFGAVAQEGEQQAVNKHSAGGSSGGSAVAVVTGEADIALGTDTGGSVRLPAAYTGVVGFK
PSYGMISRYGVVPYANSLDTVGLLAKEVRPITELILGSGEAEGLWAEHDPLDPTSLSPGA
RRRCASQRDCYHSGPLSKHPYPLKNLKFGLPLEYNITELSPSIRAAWSAAAAKLQSLGAR
LVPVSLPSTRHALSAYYVIAPAEASSNLAKYDGIRYGTRFTSPTESDAAVSEGQEEAQGN
LYARARAAGFGDEVKRRILLGAYTLSSAAMDNYFLKAQKVRRLVRRDFNRVFALPNPLLD
KPESFELSELPETVGLEDKWGPTEVDFLLCPTAPMTAPKLEEVLSEEEKDPVNAYMNDVF
TVPASLAGLPAISVPMRVQEEKEGTGMAGLQLIGQYWDDARLLAVAEAVAGVVGEEL
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgtcagctagaattgggcggctgcggggcctgtgtctgcgccatgtgagctcgacaagg
caaacgtcgcccatccagcgacgcttcctgaatcagtttatttccagagtgcaacaagat
gacctacctgtgctcgaacagcggcaattccgtcttgccgtaaaagacaacattgccacg
gtctctcccaaccccgaagaggaaacgcctctgacgacgacatgcggctccaacttcctc
gccaactaccgcagccccttcgaggccaccatcgtcacccaattgcgatcgcgcggcgct
ctcttggtcggcaagaccaacctcgatgagttcggcatgggcagccactcggtacatacg
gcctttggagcagtcgcgcaggagggggaacagcaagcagtcaacaagcactccgcaggc
ggcagctcaggtggaagtgccgtagcggtagtcaccggcgaagcggacattgctcttggc
accgacacgggcggctcagtccggttaccggccgcgtacacgggcgtggtgggatttaag
ccctcgtacggaatgatctcacgctacggcgtggttccgtacgccaactcgctcgacacg
gtaggattactggccaaggaagtgcggcccatcactgagcttattctcggatcgggagag
gccgagggtctctgggccgaacacgacccactcgaccccacgagcctttccccgggagcg
cgcagacgatgcgccagccaacgggactgctaccatagcggtcctctctccaagcaccca
tacccgctcaagaatctcaagttcggcttgccactagagtacaacatcaccgaactctcg
ccctcgatccgcgccgcctggtccgccgccgccgccaagctgcaatccctcggcgcccgc
ctcgttcccgtctccctgccctcgacccgccacgccctgtcagcttactacgtcatcgcg
cccgccgaggcttcgtccaacctggccaagtacgacggcatccggtacggtacgcggttt
acgtctcctacggaaagtgatgctgctgtttcagaaggacaggaagaagcacaaggaaac
ctctacgcccgcgcccgcgccgccggtttcggtgatgaagtcaagcgccgcattcttcta
ggcgcgtacacgctctcctcggccgctatggacaattacttcctcaaagcgcaaaaggtg
cggcggctggtgaggcgggactttaaccgcgtttttgcgctgcctaaccctctgctggac
aaaccggagagctttgagctcagcgagctgccggagacggtcgggctggaggataagtgg
gggcctacggaggtggacttcctgctgtgtccaacggcgccgatgacagcaccgaagctg
gaggaagtgctgagtgaggaggagaaggatcccgtcaacgcttatatgaatgatgttttt
actgtgccggcgagcttggcggggttgccggctattagtgtgccgatgagggttcaagaa
gaaaaggaggggacgggtatggctgggttgcagcttattgggcagtattgggatgatgcg
agactgttggctgttgcggaggctgtggctggtgttgttggcgaggagctctag

DBGET integrated database retrieval system