KEGG   Sordaria macrospora: SMAC_01588Help
Entry
SMAC_01588        CDS       T01610                                 

Definition
(RefSeq) uncharacterized protein
  KO
K17498  transcription factor SPN1
Organism
smp  Sordaria macrospora
Brite
KEGG Orthology (KO) [BR:smp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:smp03021]
    SMAC_01588
Transcription machinery [BR:smp03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     SMAC_01588
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Med26
Motif
Other DBs
NCBI-GeneID: 10810376
NCBI-ProteinID: XP_003352754
UniProt: F7VR90
Position
Unknown
AA seq 434 aa AA seqDB search
MSDAASPAGSPAAEPTEHRDEDQVNETHHDDGSNHGANNEDNDGGNDEDHQDKDSDVLSE
IDEEEFGDDYGARPVDIDENVAMKLKARRKTTTETTKKPKEGRRPKKRSRDDDDVDAADD
DGERRPRKVRAEGERRARKEEEDRAAQAEENLTPDERRRRALERAIDAAVKNPTKRRRKK
DDIDLEEETDEQIANLKVAMEKACVSDNEAREQKQPAVHKLKLLPQVTAILNRTAIQDSV
LDPEINFLQSVRYFLEPLNDGSLPAYNIQRAIMSALMKLPINKDVLLSSGIGKVIVYYNK
SKSPSADIKRDAERLLGEWSRLILKRTDDYKKRHIEMREIDVSAVRGQREGGSSQVTLTQ
RPAGKSRYEIERERALAPEVRNNNRARPVGLPASYTIAPKSTYIPGQAPTDHRPIGHSGH
EAFRRMTQKGKGKR
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgtcggacgccgcttctccggcgggttcccctgctgccgaacccactgagcatcgcgat
gaggaccaggtcaacgagacgcaccatgatgatggaagcaatcacggagccaacaacgag
gataacgatggaggcaatgacgaagaccaccaagataaggattccgatgtcctgtctgaa
atcgacgaggaggagtttggcgatgattacggcgcccggcctgttgacattgacgagaat
gtggccatgaagctgaaggcgaggagaaagacgaccacagagacgacaaagaagccaaaa
gaaggacggaggcccaagaagcggtcgcgtgatgacgatgatgttgacgctgcggatgac
gacggtgagcgccgaccacgcaaggtccgcgctgagggcgagcgacgtgctaggaaggag
gaagaggatcgggcagcacaagcggaagaaaacctcaccccagatgagcgtagacgacgc
gctttggagcgcgccatcgacgctgctgtcaagaaccccaccaagcgcaggcgaaagaag
gacgatattgacttggaagaggagacggacgaacagattgcgaacctcaaggtcgccatg
gagaaggcttgcgtatccgacaacgaagcccgcgaacaaaagcagcccgccgtgcataag
ctcaagcttctaccgcaagttaccgcgattctaaaccggaccgccatccaggactccgta
ctcgaccccgaaatcaacttcctccaatctgtcagatacttcctggaacctctgaacgac
ggaagtctgcccgcgtacaacattcagcgtgccattatgagcgcgctcatgaagctgccc
atcaacaaggatgtgcttctgagcagcggcatcggcaaagtgatcgtttactacaacaag
agcaagagccccagcgcggacatcaagcgtgatgcggagcggttgctaggcgaatggagt
cgcttgatcctgaagaggaccgacgactacaagaagcgtcacatcgagatgcgtgaaatc
gatgtcagtgccgtacgaggtcagcgcgaaggcggcagctcccaagtgacgctgacccag
cgtcccgccggcaagtcccgctacgagattgagcgcgagcgtgccctcgctcccgaagtg
cgcaacaacaaccgcgccaggcccgtcggccttcccgccagctacaccatcgctcccaag
agcacgtatattccgggccaggcgcccaccgatcatcgtcccatcggtcacagcggccat
gaggctttccggaggatgacccagaagggcaaaggaaagcgctaa

DBGET integrated database retrieval system