KEGG   Sordaria macrospora: SMAC_02589Help
Entry
SMAC_02589        CDS       T01610                                 

Definition
(RefSeq) uncharacterized protein
  KO
K09584  protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
smp  Sordaria macrospora
Pathway
smp04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:smp00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    SMAC_02589
Enzymes [BR:smp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     SMAC_02589
Chaperones and folding catalysts [BR:smp03110]
 Protein folding catalysts
  Protein disulfide isomerase
   SMAC_02589
Membrane trafficking [BR:smp04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    SMAC_02589
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin ERp29 Thioredoxin_2 OST3_OST6 Thioredoxin_7 HsbA DUF1910
Motif
Other DBs
NCBI-GeneID: 10809771
NCBI-ProteinID: XP_024511364
Position
Unknown
AA seq 345 aa AA seqDB search
MVLLKSLVVASLAAAVAAKSAVLDLIPSNFDDVVLKSGKPTLVEFFAPWCGHCKTLPPFT
RSLLPLSSTRRTRFRSPRLMPMQRESWASALVVDVTWRACLASSPRRLASSPGRRVLFLA
LSAFSTMPPSAAPLAATRTSWLLSLLPDCKNLAPTWEKLAATFASEPEITIAKVDADAPN
GKKSAAEYGVSGFPTIKFFPKGSTTPEDYNGGRSEADFVEFLNEKAGTHRTPGGGLDTVA
GTLAALDEIVTKYTGGASLTEITEEAKEAVKSLKNSAELKYADYYLRVFDKLSKNEGYAA
KEFARLEGILKKGGLAQAKVDELTAKVNVLRKFVEKAVEDVKDEL
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggtcctcctcaagagcttggtggtagccagtttggctgctgctgttgcggccaagtcc
gcggtcctcgacctcatcccctccaacttcgacgatgtcgtcctcaagtccggcaagccg
accctcgtcgagttctttgcgccctggtgcggccactgcaagaccttgcccccgtttacg
aggagcttgctaccgctttcgagtacgcgaaggacaaggttcagatcgccaaggttgatg
ccgatgcagagagagagttgggcaagcgctttggtggtggacgtgacttggagagcctgt
ctagcttcatcgccgagaagactggcgtcaagtccaggaagaagggttctgttcctagcc
ttgtcagcgttctcaacgatgccaccatcagcggcgccattggcggcgacaagaacgtct
tggttgctttcactgctccctgactgcaagaacctcgctcctacctgggagaagcttgcc
gctacctttgccagcgagcccgagatcacgattgccaaggttgatgccgatgcgcccaac
ggcaagaagtccgctgccgagtacggcgtctccggtttccctacgatcaagttcttcccc
aagggaagcaccacccctgaggactacaacggcggccgctccgaggctgatttcgtcgag
ttcctgaacgagaaggccggtacccaccgcacccccggtggtggccttgacaccgtcgct
ggcactctcgctgccctcgatgagattgttaccaagtacactggcggtgcttccctgact
gagatcaccgaggaggctaaggaggctgtcaagagcctaaagaactctgccgagctcaag
tacgccgactactacctccgcgtcttcgacaagctgagcaagaacgagggttatgccgcc
aaggagtttgcccgtctcgagggcatcctcaagaagggtggtcttgcccaggccaaggtt
gatgagcttactgccaaggtcaacgttctccgcaagttcgttgagaaggcggtggaggac
gtcaaggatgagctctaa

DBGET integrated database retrieval system