KEGG   Sordaria macrospora: SMAC_02609Help
Entry
SMAC_02609        CDS       T01610                                 

Definition
(RefSeq) uncharacterized protein
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
smp  Sordaria macrospora
Pathway
smp00450  Selenocompound metabolism
smp00970  Aminoacyl-tRNA biosynthesis
smp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    SMAC_02609
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SMAC_02609
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:smp01007]
    SMAC_02609
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:smp03016]
    SMAC_02609
Enzymes [BR:smp01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     SMAC_02609
Amino acid related enzymes [BR:smp01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   SMAC_02609
Transfer RNA biogenesis [BR:smp03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    SMAC_02609
 Prokaryotic type
   Other AARSs
    SMAC_02609
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 DUF5331
Motif
Other DBs
NCBI-GeneID: 10809803
NCBI-ProteinID: XP_003352174
UniProt: F7VWY8
Position
Unknown
AA seq 613 aa AA seqDB search
MDVLRTASARRTFKWQASGILARNSWVCRSCRSSQFVAPKAPRRTLATSTPTSTATKTPD
NKPFYVTTPIFYVNASPHVGHMYSMVLADVLKRWQKLKGNQAILCTGTDEHGTKVQRAAM
SNDMDPKQFCDLNSAKFQELAAACLIDHDRFIRTTDQDHVEAVKHFWLLLKDKGLIYEAK
HEGWYCVSDECFYPESQLEKRQDPFTGEVYVASIESGNKVEWIEEKNYHFRMTALKDQLL
EFYKNNPDWIVPHTRMNQVVDWVTNNLEDLSISRPVSRLSWGIRVPDDESQTIYVWVDAL
INYLTKAGYPTGLQDWSTQDILRFHCIYWPALLLALDLPLPKRILSHAHWTMEKKKMSKS
IGNVVNPFYAMERFGIDTMRFYMVHNGGISNDADYSNGWLTVEYKKHLQNGVGNLSARVT
RPKQWSLRRAVQSYNDGTMRLQSTGEQINDSCVEHLARLDKLASTVDNEMLQLNPSHALQ
KIMGLIGETNAFISNAEPWVVVKKPDSEALVDRIILTAGESLRIAGILLQPFMPEKAAEL
LDLLGVENDKRTFSHAKVFIDGTYGTAFRTFGKEGIFPPPMLDDIMDMKPDSGKKHSSGN
KKDRPLEVLKQDF
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atggatgtcctccgaacggcatcagctcgccgcactttcaaatggcaagcttccggcatc
ctggcgaggaacagctgggtctgccggtcatgccgcagcagccagtttgtcgcgcccaaa
gctcctcgacgaaccctcgcgacatcgacaccgacatcgacagcgacgaagacgccagac
aataagcccttctatgtcacgacgccaatattctacgtcaatgcctcgccacatgtcggc
cacatgtactccatggttctggccgatgtgctgaagcgatggcagaaactcaagggcaac
caggccattctgtgtacggggaccgacgagcacggaacgaaggtgcagcgcgctgccatg
tccaacgatatggacccgaagcagttctgcgacttgaactcggcaaagttccaggaactg
gctgccgcatgcctcatcgaccacgaccgattcatccgcactaccgatcaagaccatgtc
gaggctgtcaaacacttttggctcttactgaaagacaaggggcttatctacgaggccaag
cacgagggctggtactgcgtcagcgacgagtgcttctaccccgagtcccaacttgagaag
aggcaggaccccttcacgggcgaggtctacgtggcgtccattgagtctggaaacaaggtg
gagtggatcgaggaaaagaactaccatttccgcatgaccgctctgaaggaccagttgctt
gaattctacaagaacaaccccgactggatcgtccctcatactcggatgaaccaggtcgtg
gactgggttacaaacaacttggaagatctctcgatttcgagacctgtctctcggttgagc
tggggcattcgcgttcctgatgacgagagccagaccatatacgtttgggttgacgccctg
atcaactatcttaccaaggctggctacccaactggcctccaggactggagcacgcaggat
attcttcggttccactgcatctactggcctgctctgcttttggctttggatcttcccttg
cccaagaggatcctaagccacgcccactggactatggagaagaagaagatgtccaagtcg
atcggcaacgtcgtgaatccgttctacgccatggagcggtttggcatcgacaccatgcgt
ttctacatggtccataatggcggcatttccaacgacgcggactacagcaatggctggctc
actgtcgagtacaagaagcatctgcaaaacggagtaggaaacctcagcgcacgtgtaaca
agacccaagcaatggagcttgcgcagagcagtccagtcttacaacgatggaaccatgcgt
ctccaatcgacgggggagcagattaacgattcttgcgttgaacaccttgcccggcttgac
aagcttgcctcgactgtcgataatgaaatgctacagcttaaccctagccatgccctccaa
aagatcatgggactcattggcgagaccaacgccttcatctccaacgcggaaccctgggtc
gtagtcaagaagcctgattctgaggccttggtcgaccggattattctcaccgcaggcgaa
agtctcagaattgccggcatcctcctccagccattcatgcctgaaaaggccgccgaactt
cttgatctattgggagtcgagaacgacaagaggacgttctctcatgccaaggtattcatt
gatggtacatacggcactgctttcaggacgttcgggaaggaaggcattttccctcctcct
atgttggacgacatcatggacatgaaacccgacagtggtaagaagcacagctccggcaac
aagaaggacaggccattagaagtcttgaagcaagatttctga

DBGET integrated database retrieval system