KEGG   Sordaria macrospora: SMAC_03535Help
Entry
SMAC_03535        CDS       T01610                                 

Definition
(RefSeq) uncharacterized protein
  KO
K05236  coatomer subunit alpha
Organism
smp  Sordaria macrospora
Brite
KEGG Orthology (KO) [BR:smp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:smp04131]
    SMAC_03535
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:smp04147]
    SMAC_03535
Membrane trafficking [BR:smp04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Retrieval pathways
   Coat protein complex I (COP-I)
    SMAC_03535
Exosome [BR:smp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SMAC_03535
  Exosomal proteins of bladder cancer cells
   SMAC_03535
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Coatomer_WDAD COPI_C WD40 ANAPC4_WD40 Nup160 IPPT
Motif
Other DBs
NCBI-GeneID: 10808814
NCBI-ProteinID: XP_003351231
UniProt: F7VVG3
Position
Unknown
AA seq 1229 aa AA seqDB search
MQAPSGMLTKFESKSSRAKGIAFHPKRPWILVSLHSSTIQLWDYRMGTLIDRFEEHDGPL
EASTSTRHSLHVSLQPLFVSGGDDYKIKVWSLQTRRCLFTLNGHLDYIRTVFFHHELPWI
VSASDDQTIRIWNWQNRSLLCTMTGHNHYVMCAQFHPKEDLIVSASLDQTVRVWDISGLR
KKHSAPTSMSFEDQVARANANQTDMFGNTDAVVKFVLEGHDRGVNWVAFHPTMPLIVSAG
DDRLIKLWRMSETKAWEVDTCRGHFQNASGCLFHPHQDLILSAGEDKTIRVWDLNKRTAV
HTFKRENDRIWVIAAHPEINLFAAGHDNGVMVFKLERERPASAVYQNNIFYITKEKHVKM
YDFQKNAESPTLLSLKKLGSPWVPPRTLSYNPAERSILVTSPADGGSYELITLPRDGSGA
IEPTESKRGQGNSAVFVARNRFAVLNAATQTVDIKDLTNNTTRSFKPPVGTTDIYFGGTG
NLLIITPTAVHLYDIQQRKSTAELAVTGVKYVVWSNDGLYAALLSKHNVTIVTKTLEQVS
TLHETIRLKSAAWDDAGVLLYSTLNHVKYTLLNGDNGIVCTLDQTVYLTRVKGRNVYCLD
RAAKPKILQIDPTEYRFKLALVKRNYEEMLHIIQNSSLVGQSIIAYLQKKGYPEIALQFV
QDPTTRFELAIECGNLEVAVEMAKELDKPKLWTRLSQEALAHGNHQIVEMCYQKLKHFDK
LSFLYLTTGDHDKLSRMAKIAEHRGDFTSRFQNALYLGEVQDRIQMFKEIDLYPLAYMTA
KSHGLEDECQEILEATGLTEEQLSMPTLGEPLTPPKPVVPTYKANWPTKAASQSFFEKAL
LGEVEGLSLEDQPSAASNGFGLEEGGADELATKKGAALGEADEDEDAAGWDMGDDIVPEV
EEGFVNVESADAGGAGSSEADLWSRNSPLAVDHVAGGSFESAMQLLNRQVGAVNFAPLKP
RFLEVYQASRTYLPAAAGLDPLVNYVRRNPEETDPRKVLPIIPRDLEYLASNDLQRGYDA
MRANKLENGVKIFKSILHSVLVNAVGSDGEVAEAKKLIASACEYSVAMSIELARRQLGSP
DQLSQDPALQKRNLELAAYFTIPKIEVPHRQLALLNAMNLSVKSKNYSSALSFANRILAN
GGATKITENAKKTKAQCERNPHDAVEIEFDQFAEFEICAASFTPIYSGTPYEECAFDGAK
YHTKYKGTVCTVCEVCEVGKHGSGLKLFA
NT seq 3690 nt NT seq  +upstreamnt  +downstreamnt
atgcaggccccctcgggaatgctcaccaaattcgagtccaagtcgtcgcgagcaaagggc
atcgccttccaccctaaacgaccatggattctcgtctccctccactcctccaccattcag
ctatgggattaccgcatgggtaccctgattgatcgattcgaagaacacgatggcccgtta
gaggcgtcgacttccacaagacacagcttacacgtatccttacagcctctcttcgtttcc
ggcggtgacgactacaagatcaaggtctggtcccttcagactcggcgctgcctctttacc
ctcaacggccacttggactacattcgtaccgtcttcttccaccacgagctcccttggatt
gtcagtgctagtgacgaccagacgatccggatatggaactggcagaaccgctctctgctc
tgcacaatgacaggccacaaccactacgtcatgtgcgcccagttccaccccaaggaagac
ctcatcgtttccgcctctctcgatcagactgttcgcgtttgggatatctccggcctgcgc
aagaagcactccgcgcccacgtccatgtccttcgaggaccaagttgcccgcgccaatgcc
aaccagactgacatgttcggcaacaccgacgccgttgtcaagttcgttctcgagggccac
gaccgcggcgtgaactgggttgccttccaccccaccatgcccctgatcgtgtccgccggt
gacgaccgtctcatcaagttgtggcgcatgagcgagaccaaggcttgggaagtcgatacc
tgccgcggccatttccagaacgccagcggctgtcttttccacccccaccaggaccttatc
ctttcggctggcgaagacaagactattcgagtatgggatcttaacaagcgtactgcagtc
cacaccttcaagcgggagaacgacaggatctgggttatcgccgcgcacccggaaatcaac
ttgttcgctgctggtcacgacaatggtgttatggtgttcaagctcgagcgcgagaggcct
gcttctgccgtttatcagaacaacattttctacatcaccaaggagaagcacgtcaagatg
tacgacttccagaagaatgccgagtcgcccacacttttgtcgctcaagaagctcggaagc
ccttgggtacccccaaggacactctcctacaacccggctgagaggtccatcctggtcacc
tccccggcggatggtggttcgtacgagctgattacccttcctcgtgatggctctggagct
atcgagcccaccgaatccaagaggggccagggcaactcggctgtgtttgtcgctcgcaac
cgcttcgctgttctcaatgctgccacccagaccgtcgatatcaaggacttgaccaacaac
accaccagatcgttcaagccccctgttggcaccaccgatatctacttcggcggcaccggc
aacctccttatcattaccccgaccgctgttcacctttacgatatccagcagaggaagagc
actgccgagctggctgtgactggcgtgaaatacgtcgtctggtctaacgatggtctctac
gctgctctgctgagcaagcataatgtgacaattgtgaccaagacgctggagcaggtcagc
actctgcatgaaactattcgtctcaagagtgctgcgtgggacgacgctggtgttctgctg
tactcgactctcaaccatgtcaagtacacgcttctgaacggcgataacggcatcgtttgc
acccttgaccagactgtttaccttacccgtgtcaagggcaggaacgtctactgcctcgac
cgtgctgcgaagcccaagattttgcagattgatcccaccgagtaccgcttcaagcttgcg
cttgtcaagcgcaactacgaggaaatgctgcacatcatccagaactcgagcttggttggc
cagtctatcattgcctacctccagaagaagggctatcccgagatcgcgctccagttcgtc
caggatcctaccaccaggttcgagcttgctattgagtgcggtaatctcgaggttgcggtt
gagatggccaaggaactggacaagcccaagctgtggacgagactcagccaggaggccctc
gcccatggcaaccatcagatcgtcgagatgtgctatcagaagctcaagcacttcgacaag
ctgtcgttcctgtatctcacaaccggcgaccacgacaagctctcgaggatggccaagatt
gctgagcaccgtggtgacttcacttcaagattccagaacgccctttacctgggagaggtc
caggaccgcatccagatgttcaaggaaatcgatctgtaccccttggcctacatgactgcc
aagtctcacgggctcgaggatgagtgccaggaaatcctcgaggctactggccttacagaa
gagcagctctcgatgcccaccctgggtgaacccctaacaccgcccaagcccgtggtcccc
acatacaaggctaactggccgaccaaggcggcctcgcagtccttcttcgaaaaggccctg
cttggcgaggtcgagggtttgtctctcgaagaccagccctccgccgcttccaacggcttc
ggtcttgaagagggtggtgcggatgagcttgcgaccaagaagggcgctgctcttggtgaa
gctgatgaggatgaggatgctgcgggctgggacatgggcgatgacattgttccggaagtc
gaagagggctttgtcaacgtggagagcgcggatgccggcggtgcgggaagcagtgaagcg
gatctttggtcccgaaattccccgcttgcagttgaccacgtcgctggtggttcctttgag
tcggcaatgcagctgctcaaccgccaagttggcgctgtcaactttgcgccgctcaagcct
cgcttcttggaggtctaccaggcatccaggacttacctccctgctgcggctggtctagac
cctctcgtcaactacgtccgcaggaaccctgaggagacagatcccaggaaggttctccct
attatccccagggacctcgagtatcttgcttccaacgaccttcagcgcggctacgatgcc
atgagggcgaataagctcgaaaatggtgtcaagatcttcaagagcattctgcactccgtt
cttgtcaacgcagtaggcagtgatggtgaggttgccgaggccaagaagctgatcgcttcg
gcttgcgagtactcggttgccatgtctatcgagctagcccgcaggcaactgggttccccg
gaccagctgagccaggaccccgcgctccagaagcggaacttggaactggcggcctacttc
accattcccaagatcgaggttccccatcgccagcttgctttgcttaacgcaatgaatctg
tctgtgaagagcaagaactacagctctgcccttagctttgccaacaggatattggccaac
ggaggagccaccaagatcactgagaacgccaagaaaaccaaggcgcaatgcgagcgcaac
cctcacgacgccgtggagattgagttcgaccagttcgccgagttcgagatctgcgccgcc
agcttcacgcccatctacagcggcaccccttacgaggagtgtgcgtttgacggagccaag
tatcacactaagtacaagggcacggtgtgcacggtctgcgaggtttgcgaggttggaaag
cacggtagtggcctgaagctgtttgcttaa

DBGET integrated database retrieval system