KEGG   Sordaria macrospora: SMAC_03842
Entry
SMAC_03842        CDS       T01610                                 

Definition
(RefSeq) uncharacterized protein
  KO
K17877  nitrite reductase (NAD(P)H) [EC:1.7.1.4]
Organism
smp  Sordaria macrospora
Pathway
smp00910  Nitrogen metabolism
smp01100  Metabolic pathways
Module
smp_M00531  Assimilatory nitrate reduction, nitrate => ammonia
smp_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:smp00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    SMAC_03842
Enzymes [BR:smp01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.4  nitrite reductase [NAD(P)H]
     SMAC_03842
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox NIR_SIR Fer2_BFD Rieske_2 Rieske NIR_SIR_ferr Rubredoxin_C NAD_binding_9
Other DBs
NCBI-GeneID: 10805178
NCBI-ProteinID: XP_003347744
UniProt: F7W036
Position
Unknown
AA seq 1151 aa
MANTTPDMATSPSSSPGLTPRKRIVVVGLGMVGIAFIEKLIKLDTQRQYEIIVIGEEPHV
AYNRVVQTHLASSSLTHHLSTTALALSPQSKTLTISPPPSTPSLATLSYDHLILATGSRA
LLPTSTPGHDAQGVFVYRTISDLQNLITWSASPKIKGSTGVVVGGGLLGLEAAKALMDLE
VFGHVVVIERNGWVLSRQIDAEAGSLVLEGVRALGVEVLTKRRVKEVDTTDDQAGEVGAK
VVKSITFEDGDYLPCSTICFAIGIKPRDELARQAGIECAEKGGGGIMVDDSLQTSASGVY
AIGECASWQRQTFGLIGPGIEMADVLAFNLTQAHLHTPRVFKRPDLSTKLKLLGVEVASF
GDFFADRDGPKHLPPKVKRELKKTGKEAEVKSLTYKDPFQSIYKKYIFTSDGKYLLGGMM
IGDTSDYVRLVPLVKTQKELDILPSQLILGAKKSGDDGDNDLPDDTQICSCHNVTKADLV
NPLKSGECTSLGDLKSCTKAGTGCGGCMPLVTSIFNRTMTSLGTEVKNNLCPHFPQYSRA
DLYNIISVKQLRTLPDVMREAGAGSDAESLGCEVCKPAIASIFASLWNDHVMSPAHHGLQ
DTNDRFMGNIQRNGTFSVVPRVAAGEITPEKLIVIGEVAREYNLYTKITGGQRIDMFGAR
KQDLLKIWKKLVDAGMESGHAYAKSLRTVKSCVGTTWCRFGVGDSVGMAVRLEERYKGLR
APHKIKGGVSGCVRECAEAGNKDFGLIATDKGFNILICGNGGTTPKHSILLAKDVPPTNV
IPIIDRFLMFYIRTADKLQRTARWLEALPDGIDYLREVILDDRLGICASLEAQMQELVDS
YFDEWAEAINNPAMQERFKQFANTDEGQPPMEVEIDRGQERPVMWPREDEGGSAKTDFKE
LRDKWTSATWQPVLEVSYFKGADDLPNGISASIKRGDTQLAVWRIKGKYYASQQMCPHKR
TFALSDGLVGTEPSASSCSDAALALPPSPPSTPPSSSPSTSPPHSPTSATQPTPCSSKQQ
YPSPYISCPFHKRNFSLTSGSCKNDSELSIATFDVEERKDGMVYIKLPPVKELDRELGTK
KWMVKKGEAGEGQFGELDELTKRKGAEGKKGRRGRKPGASEAGKGVGKKLVESVGSGGGG
GGGCGGPGLEW
NT seq 3456 nt   +upstreamnt  +downstreamnt
atggcgaacacaacaccagatatggctacaagccccagttcaagcccaggtttgacacct
cgaaagaggatagtagtcgttgggttgggtatggttggtattgctttcatcgagaaactc
atcaaactcgatacccaacgacagtacgaaatcatcgttatcggcgaagaaccgcacgta
gcctataaccgcgtggtacaaacccacctcgcctcttcatccctaacccaccacctctcc
accaccgccctcgccctttctccccaaagcaaaaccctcacaatttccccaccaccatcc
acgccctccctcgctaccctctcctacgaccacctcatcctcgccaccggctcccgcgct
ctcctgcctacctccacaccaggccatgatgcgcaaggcgttttcgtctaccgcaccatt
tctgacttgcaaaatctcataacatggtcagccagcccaaaaatcaaggggtcaaccggt
gtagtcgtgggcggtggcctactaggtctggaagcagccaaagccttgatggacctggaa
gttttcggccatgtggtagtcatcgaacgcaacggctgggtcttgagtcggcaaattgac
gcagaagccggaagcctggtcttagagggtgtcagagcgttgggcgtcgaagttctgacc
aaacgccgagtaaaagaagtcgatacaaccgacgaccaagcaggggaggtcggcgcaaaa
gtggtgaaaagcatcaccttcgaagacggcgactacctcccctgttcaacaatctgtttc
gccatcggcataaagccccgcgacgaactagcacggcaagcaggcatcgagtgtgcggaa
aaaggagggggagggattatggttgatgactccctccagaccagcgcttcaggcgtttac
gccataggcgagtgcgccagttggcagcggcagacgttcgggttaatcggccctggcatc
gagatggcggatgtgctggcttttaacctcactcaagcgcatttgcacactccaagggta
ttcaagcgaccagacctcagcaccaagctcaagttgctgggtgtagaagttgccagtttt
ggggatttctttgctgaccgcgatggaccgaagcatctcccgccgaaggtgaagagggag
ttgaagaaaacgggcaaagaagcggaggttaaatccttgacgtacaaagacccttttcag
tcgatttacaaaaagtacatctttacgtccgacgggaagtaccttttgggtggtatgatg
ataggtgacacgtcggactacgtgcgtcttgtcccgctggtcaaaacacagaaagagctg
gatattctcccttcacagctcatcttgggagcaaagaaatccggcgatgacggagacaac
gacttaccagacgatacccaaatctgctcctgccacaacgtcaccaaagctgatctcgtc
aaccccctgaaatccggagaatgcacctccttgggagacctcaagtcttgcaccaaagcc
ggtacaggctgcggcggatgcatgccactggttacctcaatcttcaaccgcaccatgaca
tcgctgggaaccgaggtcaagaataacctttgtccgcacttcccgcagtactcaagagcg
gatttgtataacatcatctccgtcaagcagttgcggactttaccggatgttatgcgtgaa
gctggcgctggctccgacgctgaaagtctaggctgtgaagtctgcaaaccagccatcgct
tcaatctttgcttcgctgtggaatgaccacgttatgagtcctgctcatcacgggctgcag
gatactaatgatcggtttatgggtaatatccagcgcaacggaaccttttctgtcgtgccg
agggtagcggccggggagatcacgccggagaagttgattgttattggagaggtagcgagg
gagtataatctttacacgaagatcacgggcgggcaaaggattgatatgtttggtgcacga
aaacaggatttattgaagatctggaagaagttggtggatgcgggcatggagagcgggcac
gcgtatgcaaagagtttgaggacggtgaagagctgtgtgggcacgacgtggtgtcgattt
ggagtgggtgatagtgtgggcatggcggtgaggttggaggagaggtataaggggttgagg
gcgccgcataagattaaggggggagtgtctgggtgtgtaagggagtgtgcggaggcgggg
aataaggactttggtctaatcgccaccgacaaaggattcaatatcctaatatgcggcaat
ggtggcacgacacccaaacattccatcctcctcgccaaagacgtgcctcccacaaacgtc
atccccatcattgaccgtttcctcatgttctacattcgcaccgccgacaaactccaacgc
actgctcgctggctcgaagccctgccagacggcatcgattacctccgcgaagtcatcctt
gacgaccggctcggtatctgcgcctccctcgaagcccaaatgcaagagttggtagacagt
tacttcgacgagtgggccgaagccatcaacaacccggctatgcaagagcggttcaagcag
ttcgccaatactgacgagggacaaccgcctatggaagtagagattgaccgtggacaggaa
agaccggtgatgtggccccgggaagacgaaggcggttcagccaagacggacttcaaggaa
ttgagagataagtggacgtcagctacttggcaacccgttctcgaagtgtcgtacttcaag
ggagcagacgacttgcccaacggtatcagcgccagcatcaagcgcggtgatacccagctt
gctgtctggcggataaaggggaaatattacgcttcgcagcagatgtgtcctcataagcgc
actttcgctttgtctgacggtttggtcggtaccgagccgtcggcatcttcttgctcggat
gccgcactcgcacttccgccgtcaccacctagtactcctccgtcttcatcgccgtctaca
tccccgccccattctcccacctctgcaacacaacccacaccatgctcctccaagcaacaa
tacccctcaccttacatttcctgccccttccacaagcgaaacttctctctcacttccggg
tcctgtaagaatgatagcgagttgtccattgccacttttgacgttgaagaacgaaaagac
ggcatggtgtacatcaagttgccgcctgtcaaagaactggacagggagttggggacgaag
aagtggatggtcaaaaagggcgaagcgggtgaggggcagtttggggagttggatgagttg
actaagaggaaaggagcggaggggaagaagggcaggaggggaaggaagcctggtgccagt
gaggcaggaaagggggttgggaagaaattggttgagagcgttggtagtgggggtggtggg
ggtggtgggtgcggtggacctgggttggagtggtga

DBGET integrated database retrieval system