KEGG   Sordaria macrospora: SMAC_04216Help
Entry
SMAC_04216        CDS       T01610                                 

Definition
(RefSeq) uncharacterized protein
  KO
K11874  ubiquitin carboxyl-terminal hydrolase 16 [EC:3.4.19.12]
Organism
smp  Sordaria macrospora
Brite
Enzymes [BR:smp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     SMAC_04216
Peptidases [BR:smp01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   SMAC_04216
Ubiquitin system [BR:smp04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    SMAC_04216
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH UCH_1
Motif
Other DBs
NCBI-GeneID: 10808486
NCBI-ProteinID: XP_024510907
Position
Unknown
AA seq 622 aa AA seqDB search
MPDKTLTVAAYAAGASLAAITLIYVFGPTYFLDNDPSANSTSVFSTKKNGAVGLVNPAND
CFINSVLQALAGLGDLRLYLIRETHRRSLDGGGLYTQIIPSDVWCSGGDGDETSKWRVRG
DVPEWKAEGLQMGIVTKGLKDILDALNERPIYKKTISAAPFVKTLEIAFGQRISRQQQDA
QEFLQVVAERLCDEYHAGQRARSYAMRAAKQPSANVSFVSKTSDSAALDGPLPPLASEKA
NYADQPATPTASAVPDGGNENGGEEGFPFEGSFESQIECLTCGFRPRSTRSTFCTLTLNV
PHVATTTLNACFDGMFKTEYIEDFKCEKCRLLHAKAVLEADIQRSTSESSREKARAALAS
LELAIGTDPEKAPEGVELPDPRYAPKRKIARHIRMTGFPRILAIHLSRSIYDMSNFSQKN
LAKVAFPEQLPLGGLLQQRKYKLLGVVTHKGNHHSGHYESFRRQNVYPPFSNPGTFQPSG
AYMNTGSPSNTNQAQATQPASGQAPTPGVDGGVMPINESGSALASRERDIDTNSLRSAAA
SARSTLSRIASKPSSRAGSPDTAGSKPNNKIPSTSAKSKRQKSSNRWWRISDDKVKEAST
RDVLGMQREVYLLFYELERENS
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgcctgataagacactcacagtagccgcctacgcagctggtgcttctctcgccgcgatc
acgctgatttacgttttcggtcccacctatttcctcgataacgacccgtcggctaactca
accagcgtgttctcgaccaagaagaatggtgcagtgggcctagtcaacccggcaaacgat
tgcttcatcaactcagttctccaggctctcgctggccttggggacctccgtttatacctt
atccgggagacgcatcgtcgaagcctggacggcggagggctgtatacgcagatcatcccc
agcgatgtctggtgtagtggtggcgatggcgatgagacaagcaaatggcgagtccgtggg
gatgtacccgagtggaaagccgaaggactccaaatgggtatagtcaccaagggcttgaag
gacattcttgacgccttgaacgagagaccgatttacaaaaagacgatttcggccgcgccc
ttcgtcaagacgttggagattgcgtttggtcagcggatcagcagacagcaacaggacgcc
caagagtttcttcaggtcgtggccgagaggctttgcgacgagtaccacgcggggcaaaga
gcgcgaagctatgctatgcgtgcagccaagcaaccgtctgcgaacgtatccttcgtcagc
aagacatcagacagtgcagctctggatgggcctttacctccactggccagtgagaaggcc
aattacgcagatcaaccggcgacgccgaccgcgagcgcggtccccgacggcggcaacgaa
aacggaggagaagaaggttttcccttcgaagggagctttgagtcccaaattgaatgcctg
acttgtggtttcagaccgaggtccactagatcaacattctgcaccttgacactaaacgtc
ccccatgttgctacgacaaccttgaacgcatgcttcgacggcatgttcaaaacggagtac
atcgaggatttcaagtgtgaaaagtgccggttactgcatgcaaaggccgttctcgaagca
gatatccagcggtcaacgtcagagtcttcaagggagaaagcccgcgctgctctagcaagc
ctcgagctagctattgggactgatcctgagaaggcaccagagggcgtcgagttgccggat
cctcgctatgctcctaagcggaaaatagctcggcacatccgtatgacaggatttcccagg
atcctggccatccatctctcgcggtcgatctacgacatgagcaacttctctcaaaaaaat
cttgcgaaggttgcgtttccggagcaactacctcttggtggccttcttcagcagagaaaa
tacaagcttctcggcgttgtgacgcacaagggcaatcaccatagcggccattatgagtcg
tttagacgacagaatgtatatccacccttctcaaatcccggtacctttcagccttccgga
gcatacatgaacaccggttccccttcaaataccaaccaggcacaagccactcagcccgca
tccggacaggctcctacaccaggagtagacggcggtgtcatgcctatcaacgagtccgga
tcagcattggcgtctcgggaaagggatatcgacaccaatagcctacgatctgcggccgca
tcagcgcgctcaaccttgagcagaattgcctcaaagccgtcctctcgcgctggcagccca
gacacagccggatcgaaacccaacaacaagatacccagcacaagtgcgaaatctaaacga
cagaagtcaagcaaccgatggtggcgtatcagtgacgacaaggtcaaagaagcaagtacc
cgcgacgtactgggcatgcagcgagaggtctatttgctgttttatgaacttgaacgcgag
aattcatga

DBGET integrated database retrieval system