KEGG   Sordaria macrospora: SMAC_04608Help
Entry
SMAC_04608        CDS       T01610                                 

Definition
(RefSeq) uncharacterized protein
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
smp  Sordaria macrospora
Pathway
smp00860  Porphyrin and chlorophyll metabolism
smp01100  Metabolic pathways
smp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:smp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SMAC_04608
Enzymes [BR:smp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     SMAC_04608
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     SMAC_04608
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO HI0933_like Pyr_redox Pyr_redox_2 MCRA Thi4
Motif
Other DBs
NCBI-GeneID: 10802711
NCBI-ProteinID: XP_003345377
Position
Unknown
AA seq 654 aa AA seqDB search
MMYSTSQRSLARNTRRCVSSKWAQPATLSSSRLASTCAFGSAVTTSKRHNATCSALAATG
KTRSYSTSVPPPTTELPKDIAIIGGGLTGLATAYFAKLHNPHARITVYEASNRLGGWIDT
EEVHVTTPSGEEGKVLFQRGGRMLKTMKNKAKYDDLIFWKLVADLDLENELEVTNEHEPL
GNYIYYPDHLVAMPQPILDKNRPLDSAASIYSAVQTTLNEPIFKGAGSAAMKYFFGGGRK
KTLKDGEDQSVYDFFRRATGTPELINNTLGALMHGVWGGNIRNLSMQSGLFSKVTLPSPE
KGKIWYPKEDYEFMRRMFRVYSPDDMTKFLRNYMAKGENSEYIWFKNGFSTMTDALIREL
MDRGMNVTFKLNTPVQSISLHPSQKIAIKSNKNVQAALHDKVVSTIYAKTLAGLTVNKLP
SLARSTAVTIRVVNIWYPTPNLNAPFNGIGYLIPSTTPDNHEGILGVLFDSDREHRGRNY
GGDTVPGTKLTVMMGGHYWDTEPSYMYDENKCINMAKRAVERHLQISEEDAAGAVATTKL
CRDCIPQHTVGHRERMADAHHELLKAFKGNLSVVGGSYQTPGINSALRGAADIAYELSNK
MVPHPVGNTGLQRFTRPMSESWIQDEKEIFPLKFGNPFKTIFRMLSADARSRLE
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgatgtacagtactagtcagcgcagtctggcgcgcaacacgcggcggtgcgtcagcagc
aagtgggcgcaaccagcaaccctatcgagttcacggctcgcaagcacttgtgcttttggc
tccgcggtaaccaccagcaagagacacaatgccacctgctccgccctcgccgccactggc
aagacccgatcatattcgacgtcggtaccgcccccaacgacagagctcccgaaggatatc
gcgatcatcggaggtggtttgaccggcttggccacggcctacttcgctaaactccacaac
ccccatgcacgcatcacagtctacgaggcgtctaacaggctcggcggctggattgacacg
gaggaggtccatgtcacaaccccgtcaggcgaagagggcaaggtgctcttccagcgcggc
ggccgcatgctcaagacgatgaagaacaaggccaagtacgatgatttgatcttctggaag
ttagtggccgacctcgacttagaaaacgaacttgaagttacgaacgaacacgagcctttg
ggcaactacatctattaccccgatcatcttgtcgcgatgccgcagcccatcttggacaag
aatcgaccccttgattcggcagcttcgatttatagcgcggtgcaaacaaccttaaacgag
cccatttttaagggtgccggttcggccgctatgaaatacttttttgggggcgggcgcaaa
aagacgctcaaggacggagaagatcaatcggtctacgacttcttccggcgcgctacggga
actcctgagcttattaacaacactctcggcgctttgatgcatggcgtatggggcggcaat
atacggaacctcagtatgcagagcggcctgttctccaaggtgacattaccgagcccggaa
aagggtaaaatctggtatccaaaggaggattatgagttcatgaggaggatgtttcgggtg
tactcacccgacgacatgaccaagttcctgcgcaattacatggccaaaggagagaactcg
gaatatatctggttcaagaatggctttagcaccatgacagacgcactcatacgggagttg
atggatagggggatgaacgtcactttcaagctcaacactcccgtgcagtctatctctctt
cacccatcacaaaagatagcgatcaaatccaacaaaaatgttcaggccgccctacacgac
aaagtcgtgtcaacaatctacgcaaagactctggccgggctcacagtcaacaagcttccc
tctctagcacgctcgaccgccgtcaccatccgagtcgtcaacatctggtacccaacccca
aacctcaacgcaccattcaacggtatcggctatcttatcccctcaaccacgccggacaac
catgagggcatcctcggcgtgctcttcgactcggaccgcgagcatcgcggccgcaactac
ggcggtgacaccgtccccggcaccaagttaactgtcatgatgggcggccactactgggat
acggagccgtcctacatgtacgacgagaacaagtgcatcaacatggccaagagggccgtc
gagcggcacctgcagatctccgaggaggacgccgctggcgccgtggccaccaccaagctc
tgccgcgactgcatcccgcagcacacagtcggccaccgtgagcgcatggcggacgcgcac
cacgagcttctcaaggccttcaagggcaacctgtccgtggtgggcggctcgtaccagacg
cccgggattaacagcgcgctgcgcggcgctgcggacattgcttacgagttgtcgaacaaa
atggtgccgcacccggttgggaatacgggtctgcagcggttcaccagaccgatgtcggag
tcttggatccaggatgagaaggaaatattcccgttgaagtttggcaacccgttcaagacc
attttcaggatgctttcggccgatgctcgcagccggctggaatag

DBGET integrated database retrieval system