KEGG   Sordaria macrospora: SMAC_06174Help
Entry
SMAC_06174        CDS       T01610                                 

Definition
(RefSeq) uncharacterized protein
  KO
K19668  cellulose 1,4-beta-cellobiosidase [EC:3.2.1.91]
Organism
smp  Sordaria macrospora
Pathway
smp00500  Starch and sucrose metabolism
smp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SMAC_06174
Enzymes [BR:smp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.91  cellulose 1,4-beta-cellobiosidase (non-reducing end)
     SMAC_06174
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_6
Motif
Other DBs
NCBI-GeneID: 10802205
NCBI-ProteinID: XP_003344888
UniProt: F7W693
Position
Unknown
AA seq 396 aa AA seqDB search
MKFSNSAALAFAATAIAAPSTPTSQDKPRAIQAGCASAVTLDASTNVWKKYTLHANKFYR
TEVEAAVQAISDSSLASQAAKVADVGSFLWLDTIANIGKLEPALEDVPCDHILGLVIYDL
PGRDCAAKASNGELKVGELNKYKTEYIDVIVKILKAHPKTAFALVIEPDSLPNLVTNADV
QACKDSASGYRDGVAYALKNLNLPNVVMYIDAGHGGWLGWDANLKPGAQELAKAYKAAGS
PKQVRGIATNVAGWNQWDLSPGEFSKASDAKYNKCQNEKLYLDNFGPALKSAGMPNHAIV
DTGRNGVSGLREEWGNWCNVNGAGFGTRPTSTTGHDLADAFVWVKPGGESDGTSDSSATR
YDSFCGKSDAYQPSPEAGNWNQEYFEMLLKNAKPAF
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaagttctccaactccgccgcgctggccttcgccgccaccgccattgctgccccttct
acccctacttcccaggacaagcctcgcgccatccaggccggctgcgcctcggccgtcact
ctcgacgccagcaccaacgtgtggaagaagtacacgctccacgccaacaagttctaccgc
accgaggtcgaggcggccgtccaggccatctcggattcgagcctggcgtcacaggccgcc
aaggtagccgacgtcggcagcttcctctggctggacacgatcgcgaacattggcaagctg
gagccggcgctcgaggacgtcccctgcgaccacatcctgggcttggtcatctacgacttg
cccggccgtgactgcgctgccaaggcctccaacggcgagttgaaagttggcgagctcaac
aagtataagactgagtatattgatgtcatcgtcaagatcctcaaggctcaccccaagacc
gccttcgcgctcgtcatcgagcccgactcgctccccaacctggtcaccaacgcggacgtg
caggcttgcaaggactctgcttcgggttaccgcgacggcgtcgcctacgccctcaagaac
ctcaaccttcccaacgtcgtcatgtacatcgacgcgggccacggcggctggctcggttgg
gatgccaacctcaagcctggagcgcaggagttggccaaggcctacaaggctgccggatct
cccaagcaggtccgcggtatcgccaccaatgttgctggatggaaccaatgggacctctcc
cccggcgaattctccaaagcctccgacgccaaatacaacaagtgccaaaacgagaagctg
tacctcgacaacttcggccctgcgctcaagtcggccggcatgcccaaccacgccatcgtc
gacacgggccgcaacggcgtctcgggtctgcgcgaggagtggggcaactggtgcaacgtc
aacggcgccggcttcggcacccgcccgacctcgaccacgggccacgatctcgcggacgct
ttcgtctgggtcaagcccggtggcgagtcggacggtacgagcgatagctccgcgactagg
tacgatagcttctgcggaaagagcgatgcgtatcagccgagcccagaggcgggtaactgg
aaccaggagtactttgagatgttgttgaagaatgctaagcctgctttttga

DBGET integrated database retrieval system