KEGG   Sordaria macrospora: SMAC_08272Help
Entry
SMAC_08272        CDS       T01610                                 

Definition
(RefSeq) uncharacterized protein
  KO
K14565  nucleolar protein 58
Organism
smp  Sordaria macrospora
Pathway
smp03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:smp00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    SMAC_08272
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:smp03009]
    SMAC_08272
Ribosome biogenesis [BR:smp03009]
 Eukaryotic type
  Sno RNPs
   Box C/D snoRNPs
    SMAC_08272
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nop NOP5NT SPT6_acidic
Motif
Other DBs
NCBI-GeneID: 10802600
NCBI-ProteinID: XP_003345262
UniProt: F7W9Z4
Position
Unknown
AA seq 594 aa AA seqDB search
MPLFILTETSAGYGLFKAADKKLLSDDNLADRLNSVEKITKEIKYKEFAKFESAASALEE
IAGVVEGKVTPKLNSLLAEIGSEKKVTLAVAETKLGAAINKIPGLDIQPVADSTTTDLFR
AIRQYLPELIPGMLPENFKEMSLGLSHSLSRHKLKFSPEKVDVMIVHAVSLLDELDKELN
TYAMRVKEWYGWHFPELAKILPDNLSYARIIVTMGMRSNAPTTDLSEILPHEIEAAVKAA
ADISMGTEVSEEDLQNIKYLAERVIDYSVYRKQLSDYLENRMRAIAPNMTELVGALVGAR
LIAHAGSVMNLAKNPGSTIQILGAEKALFRALKTKHATPKYGLIYHASLVGQASGANKGK
MARQLASKVALGVRTDALAEFPEDADDETRANLGIRSRAKLENNLRQLEGKPISSKGVSV
GPNGIPVAAAPKWDIKEARKYNIDADGMAADAEAPNKPLIQEVEMKDAPADSDEEMKDVS
EKKSKKEKKEKKDKKAKKELDDEDFERLAKAAGMSADKFKRRFERGQISIKEDGTLEVLS
KKDFKGKAEEVEEEAEEEKPAKKSKSSKRKAEAEDEETTKEEKPKKKKKKSSKE
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atgcctctctttatcctaacagaaaccagtgccggttatggcctgttcaaggcggcagac
aagaagctgctgtccgacgacaacctcgccgaccgtctcaacagcgttgagaagatcacc
aaggagatcaagtacaaggagttcgccaagttcgagagcgccgcctctgcccttgaggaa
atcgccggtgttgttgagggcaaggtcacccccaagctgaacagcctgcttgccgagatt
ggaagtgagaagaaggtcaccctcgccgttgctgagaccaagctcggtgctgccatcaac
aagattcccggcctcgacatccagcccgttgccgactccaccaccaccgacctcttccgt
gccatccgccagtatctccctgagctcattcctggcatgctccccgagaacttcaaggag
atgtccctcggtctctctcactctctctctcgccacaagctcaagttctcccccgagaag
gtcgatgtcatgatcgttcacgccgtctcgctcctcgacgagcttgacaaggagctcaac
acctacgccatgcgtgtcaaggaatggtacggctggcacttccccgagttggccaagatc
cttcccgacaacctttcttatgctcgcatcattgtcaccatgggcatgcgctctaacgcc
cccaccaccgatttgtccgagattcttccccacgagattgaggctgccgtcaaggccgcc
gccgatatttccatgggtactgaggtttccgaggaggatctccaaaacatcaagtacctc
gctgagcgcgtcatcgactactccgtctaccgcaagcagctctctgactacctcgagaac
cgcatgcgcgccattgctcccaacatgaccgagctcgtcggcgctcttgtcggtgctcgt
ctcattgcccacgctggttccgtcatgaaccttgccaagaaccccggttctaccatccag
attctcggtgccgagaaggcccttttccgtgccctcaagaccaagcacgccactcccaag
tatggtctcatctaccacgcttctctcgttggccaggcttccggtgccaacaagggtaag
atggctcgtcagctcgcctccaaggtcgcccttggtgtccgtactgatgctcttgccgag
ttccccgaggatgccgatgatgagactcgcgccaaccttggtatccgctcgcgcgccaag
cttgagaacaacctccgccagctcgagggcaagcccatttccagcaagggtgtctctgtc
ggccccaacggtatccccgtcgctgctgcccccaagtgggacatcaaggaggctcgcaag
tacaacatcgatgctgacggcatggccgctgatgctgaggctcccaacaagccccttatc
caggaggttgagatgaaggatgcccccgccgattcggatgaggagatgaaggatgtctct
gagaagaagtccaagaaggagaagaaggagaagaaggacaagaaggccaagaaggagctc
gacgacgaggactttgagcgtctcgccaaggccgctggcatgtctgccgacaagttcaag
cgccgcttcgagcgtggccagatcagcatcaaggaggacggcaccctcgaggttctcagc
aagaaggacttcaagggcaaggccgaggaggtcgaggaggaggctgaggaggagaagccc
gccaagaagtccaagagctccaagcgcaaggctgaggccgaggatgaggagacaacgaaa
gaggagaagcccaagaagaagaagaagaagtccagcaaggagtga

DBGET integrated database retrieval system