KEGG   Sordaria macrospora: SMAC_08748Help
Entry
SMAC_08748        CDS       T01610                                 

Definition
(RefSeq) putative calcium/calmodulin-dependent protein kinase type I
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
smp  Sordaria macrospora
Brite
KEGG Orthology (KO) [BR:smp00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:smp01001]
    SMAC_08748
Enzymes [BR:smp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     SMAC_08748
Protein kinases [BR:smp01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   SMAC_08748
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal APH Kdo
Motif
Other DBs
NCBI-GeneID: 10801791
NCBI-ProteinID: XP_003344498
UniProt: F7WAR9
Position
Unknown
AA seq 465 aa AA seqDB search
MSTANGQTPAVQPCRYKVGKTLGAGSYSVVKECVHIDTGRYYAAKVINKRLMAGREHMVR
NEIAVLKKVSMGHQNILTLVDYFETMNNLYLVTDLALGGELFDRICRKGSYYESDAADLI
RATLSAVAYLHDHGIVHRDLKPENLLFRTPEDNADLLIADFGLSRIMDEEQFHVLTTTCG
TPGYMAPEIFKKTGHGKPVDLWALGVITYFLLCGYTPFDRDSDFEEMQAILNADYSFTPL
EYWRGVSDSAKDFIRKCLTIDPAKRMTAHEALQHSFVAAWGRGADADGNADKGANLLPTV
KKNFNARRTLHAAIDTVRAINKLREGQLMNGGRSREPAAKKKPAVPAVGGPGVDDGLAVA
LGPTLGKEASMVSTASSNLTKDSGYGTQQEGGSSRDDEDGDGDDVLMRDASAASTPSSDP
APPPVPAHTSVSVPAGVPSILRPGSIENKVVETGKGLWNGTSVKR
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgagtaccgccaacggtcaaacaccagcagtgcagccgtgtcgatacaaagttggcaag
actttgggcgccggttcatactcggtcgtcaaggaatgcgtacacattgacaccggtcgc
tactatgcggccaaggtgattaacaagcgcctgatggccggccgggaacacatggttcgt
aatgaaatcgccgtgctcaagaaggtctccatgggccaccagaacatcctgaccctcgtc
gactacttcgagaccatgaacaacctctacctggtcaccgacctcgctctgggcggcgag
ctcttcgaccgcatctgccgcaagggatcatactacgaatccgacgctgccgaccttatc
cgcgccaccttatccgccgtcgcctacctgcacgaccatggcatcgttcaccgcgacctc
aagcccgaaaacctgctcttccgcacccctgaggacaacgccgacctgctgatcgccgac
tttggtttgtcgcgcatcatggacgaggagcaattccacgtgctgaccaccacctgcggc
acaccgggttacatggcgccggagatcttcaaaaagaccggccacggcaaacccgtcgat
ctctgggccctgggcgtaatcacttatttcctgctgtgcggctacacccccttcgaccgc
gactcagacttcgaggagatgcaagcgatcctcaacgccgattactccttcaccccgctc
gagtactggcgcggcgtgtcggacagcgccaaggatttcatcaggaagtgtctgaccatc
gacccggccaagcgcatgaccgcccacgaggcgctgcagcactccttcgtcgccgcctgg
ggtcgcggcgccgacgctgacggaaatgccgacaagggcgcgaacctgctgccgacggtc
aagaagaacttcaatgcgcgtaggacgctgcatgcagctatcgataccgtgcgtgctatt
aacaagcttcgggagggccagttgatgaatggcgggaggagccgtgagccggcggcgaag
aagaaaccggcagtaccagcagtaggaggtccaggcgtagatgacgggttagcagtagcg
ctcggcccaacgctcggaaaggaggctagcatggtgtcgacggctagtagtaacctcacc
aaggatagcgggtatgggacgcagcaggaggggggaagctctagggatgatgaggatggg
gatggagacgacgttcttatgagggatgcgtctgccgcgtcaacaccatcgtcagatcca
gcgccaccgccggtgccggcgcatacatctgtgtctgtgcctgcgggcgtgccgagtatt
ctacggccgggcagtatcgagaataaggttgtcgagactgggaaggggttgtggaatggg
actagtgttaagcgatga

DBGET integrated database retrieval system