KEGG   Sordaria macrospora: SMAC_08873Help
Entry
SMAC_08873        CDS       T01610                                 

Definition
(RefSeq) uncharacterized protein
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
smp  Sordaria macrospora
Pathway
smp00260  Glycine, serine and threonine metabolism
smp00750  Vitamin B6 metabolism
smp01100  Metabolic pathways
smp01110  Biosynthesis of secondary metabolites
smp01230  Biosynthesis of amino acids
Module
smp_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:smp00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SMAC_08873
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SMAC_08873
Enzymes [BR:smp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SMAC_08873
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-GeneID: 10801409
NCBI-ProteinID: XP_003344130
UniProt: F7WAZ2
Position
Unknown
AA seq 554 aa AA seqDB search
MSNGVATNGNGSQDQTHTPSQRYLSTRGEDSGLSFEDVVLKGLASDGGLYIPEEVPVVPE
SVWQSWKDLSFTDLAYNIISLYISPSEIPAEDLKDIINRSYATFRTPDVTPLVHLQGSIH
LLELFHGPTFAFKDVALQFLGNLFEYFLVRKNQGKEGRDRYHLTVVGATSGDTGSAAIYG
LRGKKDVSVFMLHPKGKVSPVQELQMTTVLDANVHNLAVTGNFDNCQDIVKALFADPEIN
STHKLGAVNSINWARILAQTVYYFYSYFSLARQSESFNIGDKVRFVVPSGNFGDILAGYF
AFRMGLPVDKLVIATNENDILDRFWKTGCYTKKPVSSSKAEGGLPEDGVKAHEDGVKETM
SPAMDILVSSNFERLLWFLAYQFASSAGMDDEWNKKQAGQEVSSWLKDLKEKGGFGPVYK
DVLESARRNFESERVSDEETLDTIKSLYQEVGYVLDPHTAVGVEAARRSVKRAGDNIPHI
SLSTAHPAKFSGAVTLSLKDEAGFDFEAKVLPQEFVGLDKKEKRVNDVANDWMAVRELVR
KQVDEELKARDDSA
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacggcgtcgcgaccaacggcaatggatcccaggatcaaactcataccccttcc
cagcgctacttgagcacgcgcggtgaggacagcggtctctccttcgaagacgtcgtcctc
aagggtctcgcctccgacggcggtctctacatccccgaagaggtgcctgtcgtgcccgag
tccgtatggcaaagctggaaggacctctccttcaccgacctcgcctacaacatcatctcc
ctctacatctccccttcagagatccccgccgaagacctcaaagacatcatcaaccgctcc
tacgccaccttccgcacccccgacgtcactcccctcgtccacctccagggcagcatacac
cttcttgagctgttccacggcccgaccttcgccttcaaggatgtcgccctccagttcctc
ggcaacctctttgagtacttcctcgtgcgcaagaaccagggcaaagagggaagggacagg
taccacttgaccgttgttggtgcgacaagcggtgacaccggttctgccgccatctacggt
ctgcgcggcaagaaggatgtctccgtcttcatgcttcaccccaagggcaaggtgagcccc
gtccaggagctccagatgaccactgtcctcgatgccaacgtccacaaccttgccgtcact
ggcaacttcgacaactgccaagacattgtcaaggccctcttcgccgaccccgagatcaac
tctacccacaagctcggcgccgtcaactccatcaactgggcccgtatccttgctcagact
gtctactacttttactcttacttctcccttgcccgtcagtccgaatccttcaacattggc
gacaaggttcgcttcgtcgttccctcgggcaacttcggcgacatcctcgccggctacttc
gctttccgcatgggtctccccgtcgacaagctcgtcatcgccaccaacgagaacgatatc
cttgaccgcttctggaagacaggctgctacaccaagaagcccgtcagcagctccaaggcc
gagggcggtcttcccgaggacggcgtcaaggcgcacgaggatggagtcaaggagaccatg
agccccgccatggacatccttgtatcgagcaactttgagcgcctgctgtggttcctcgcc
taccagttcgcctccagcgccggcatggacgacgagtggaacaagaagcaggccggtcag
gaggtcagctcctggctcaaggatctcaaggagaagggcggtttcggtcccgtctacaag
gacgttctcgagagcgcgcgccgcaacttcgagtccgagcgcgtcagcgacgaggagacc
ctcgacaccatcaagagcctgtaccaggaggtcggctacgtactggacccccacaccgcc
gtcggcgtcgaagccgccaggaggtcggtcaagcgcgccggtgataacatcccccacatt
tccctctcgacagcccaccccgccaagttctcgggcgccgtcactctttcgctcaaggac
gaggccgggttcgacttcgaggccaaggtgctaccgcaggagtttgtcggtctggacaag
aaggagaagcgcgtcaacgatgtggccaatgactggatggcagtgagggagctggtcagg
aaacaagtagatgaggagttgaaggcgcgggatgattctgcatag

DBGET integrated database retrieval system