KEGG   Sinorhizobium meliloti BL225C: SinmeB_0498Help
Entry
SinmeB_0498       CDS       T01884                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
smq  Sinorhizobium meliloti BL225C
Pathway
smq00071  Fatty acid degradation
smq00072  Synthesis and degradation of ketone bodies
smq00280  Valine, leucine and isoleucine degradation
smq00310  Lysine degradation
smq00362  Benzoate degradation
smq00380  Tryptophan metabolism
smq00620  Pyruvate metabolism
smq00630  Glyoxylate and dicarboxylate metabolism
smq00640  Propanoate metabolism
smq00650  Butanoate metabolism
smq00900  Terpenoid backbone biosynthesis
smq01100  Metabolic pathways
smq01110  Biosynthesis of secondary metabolites
smq01120  Microbial metabolism in diverse environments
smq01130  Biosynthesis of antibiotics
smq01200  Carbon metabolism
smq01212  Fatty acid metabolism
smq02020  Two-component system
Brite
KEGG Orthology (KO) [BR:smq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SinmeB_0498
   00630 Glyoxylate and dicarboxylate metabolism
    SinmeB_0498
   00640 Propanoate metabolism
    SinmeB_0498
   00650 Butanoate metabolism
    SinmeB_0498
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SinmeB_0498
   00072 Synthesis and degradation of ketone bodies
    SinmeB_0498
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SinmeB_0498
   00310 Lysine degradation
    SinmeB_0498
   00380 Tryptophan metabolism
    SinmeB_0498
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SinmeB_0498
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SinmeB_0498
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SinmeB_0498
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:smq04147]
    SinmeB_0498
Enzymes [BR:smq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SinmeB_0498
Exosome [BR:smq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SinmeB_0498
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AEG03441
UniProt: A0A0E0U9Y7
Position
complement(536602..537795)
Genome map
AA seq 397 aa AA seqDB search
MNASSDPARTPVVIAALRTPVGRVNGSLAAVEPARLAALLIERIIADTGIDRAEIDDVLV
GNAANSAGNLARLAALEAGLPVAIPGVTVDRQCGSGLEAIVLAARQIQAGAGRFYLAGGT
ESASRAHIRLRPPLTRGEEPQPVKRARMAPDSIGDPDMGVAAENVATACGISRERQDRFA
LESHRRAVAAEAEGRFSREIVPVPTPEGPIARDECPRANASAETLSRLRPVFVAGGTVTA
GNACPVNDGAAMVLMTNLAEARKLGARFGLAFTDAATAGVEPKLLGLGPVPAMAKLRARN
PALDVARVDFIEFNEAFASQVLGSLDQLDIAPERVNRDGGAIALGHPYGASGAILVVRLF
SQMLAASSPAEGLAMMGIGGGMGIAAHFSSCRPDQAA
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
ttgaacgcctcgtctgaccccgctcgcaccccggtcgttatcgccgcgctgcggacgccg
gtcggccgcgtcaacggcagccttgctgcggtcgaaccggcacgccttgccgccttgctg
atcgaaaggatcattgcggatacgggcatcgaccgggcagagatcgacgacgtgctcgtc
ggtaatgccgccaacagtgccggcaatctcgcgcgcctggccgcgctcgaggcaggattg
cccgtcgcaattccgggcgtcaccgtcgaccgtcaatgcggttcggggctggaggcgatt
gtccttgcggcccggcagatccaggccggcgcggggcgcttctaccttgccgggggcacc
gagagcgccagtcgcgcccatatccgccttcggcccccgctcacgcgcggcgaagagcct
cagccggtcaagcgcgcgcggatggctcccgactcgatcggcgatccggatatgggcgtt
gcggcggagaacgtcgcgactgcctgcggcatctcgcgtgagcggcaggatcgttttgcg
ctcgaaagccaccgacgcgccgttgcggccgaagcggagggccggttctcgcgcgagatc
gtgcccgtgccgacaccagaggggccgatcgcgagggacgaatgtcctcgcgcaaacgcc
tctgccgagacgctctcgcgactgaggccggttttcgttgccggcggcaccgtcaccgcc
ggaaatgcctgcccggtcaatgacggcgcggcgatggtactgatgacgaacctcgcggag
gcgcggaagctcggtgcgcgcttcggcctcgctttcaccgatgctgcgacggccggcgtc
gaaccgaagctgctcggcctcggccccgtccccgccatggcgaagcttcgcgcgcgcaat
cccgcgctcgatgtggcccgcgtcgatttcatcgaattcaacgaggcctttgcctcgcag
gttctcgggagcctcgaccagctcgatatcgcacccgaacgcgtcaatcgcgacggcggc
gcgatcgcgctcggccacccctatggcgcttccggcgccattctcgtcgtccggctgttt
tcgcagatgttggcggcttcatccccggccgaggggctggccatgatgggcatcggcggc
ggcatggggatcgccgcccacttcagcagctgcagaccggatcaggcggcatag

DBGET integrated database retrieval system