KEGG   Sinorhizobium meliloti BL225C: SinmeB_0582Help
Entry
SinmeB_0582       CDS       T01884                                 

Definition
(GenBank) haloacid dehalogenase, type II
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
smq  Sinorhizobium meliloti BL225C
Pathway
smq00361  Chlorocyclohexane and chlorobenzene degradation
smq00625  Chloroalkane and chloroalkene degradation
smq01100  Metabolic pathways
smq01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:smq00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SinmeB_0582
   00361 Chlorocyclohexane and chlorobenzene degradation
    SinmeB_0582
Enzymes [BR:smq01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     SinmeB_0582
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase HAD
Motif
Other DBs
NCBI-ProteinID: AEG03521
UniProt: A0A0E0UA84
Position
complement(625545..626207)
Genome map
AA seq 220 aa AA seqDB search
MSYAAYVFDAYGTLFDVHAAVRRHAEAIGPDGQAFSELWRAKQLEYSWVRSLMGAYVDFW
ELTEQSLDYAFQRFPSADPKLKKPLLDAYWALDCYPEVPAVLKGLKELGARIAILSNGSP
AMLASAVKNAALDIIIDDVFSVDAVKAFKTAPAVYDLVTTSYRLYPQAVSFQSSNRWDIA
GATKFGFRTVWINRADGPDEYKDHGPSLILPSLESLQFGI
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgtcttacgcggcctatgtcttcgacgcctatggcacgcttttcgacgtgcatgcggcc
gtacgccggcacgccgaggcgatcgggccggacggccaggccttttcggaactctggcgc
gccaagcagctcgaatattcctgggtgcgctcgctgatgggcgcctatgtcgacttctgg
gaattgaccgagcaatcgctcgactacgcctttcagcgcttcccctccgccgatcccaag
ctcaaaaagcctcttctcgatgcctattgggcgctcgactgttatccggaagttcccgct
gtcctcaagggattgaaggaactcggcgcccgtatcgccattctttccaacggttcgccg
gccatgttggcctcggccgtcaagaacgccgccctcgatatcatcatcgacgacgttttc
tcggtggatgccgtcaaggcgttcaagacggcaccggctgtctacgatctggtgacgacg
agctaccggctctacccgcaggcggtctcgttccagtcctcgaaccggtgggatatcgcc
ggcgccacgaaattcggttttcgcacggtctggatcaacagagccgacgggccggatgaa
tacaaggaccatggtccttcgctgatcctcccctcgctcgaaagcttgcagttcggcata
tga

DBGET integrated database retrieval system