KEGG   Sinorhizobium meliloti BL225C: SinmeB_1145Help
Entry
SinmeB_1145       CDS       T01884                                 

Definition
(GenBank) Protein-L-isoaspartate(D-aspartate) O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
smq  Sinorhizobium meliloti BL225C
Brite
Enzymes [BR:smq01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     SinmeB_1145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT RrnaAD Methyltransf_25 Methyltransf_31 Methyltransf_11 Methyltransf_12 Methyltransf_24 MTS Methyltransf_32 Methyltr_RsmB-F Methyltransf_23 TehB Methyltransf_4 Methyltransf_3 PrmA
Motif
Other DBs
NCBI-ProteinID: AEG04071
UniProt: A0A0E0UBS2
Position
1193142..1193801
Genome map
AA seq 219 aa AA seqDB search
MNFEAARIKMVDNQIRTTDVTSHSVLSAFLSVPREEFVPAKMRELAYIDTDIELVGGSQP
RYLMEPSPLAKLLQLAEISKSDLVLEIGCGTGYASALLSLLAGSVVALESDEALAATATA
TLTRLGYDNVAVVSGDLTKGYAAEAPYDVIFIDGAVEMLPAELFEQLRDGGRLVAVEGFG
NASRAKLYVRESGMTSERADFNTAVKPLPGFRRDRSFVF
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgaacttcgaagcagcccgcatcaagatggtggacaatcagatccggaccacggatgtg
acctcccattcagtcctgtctgctttcctgtcggtcccgcgtgaggagttcgtgcctgcc
aagatgcgggagctggcctatatcgacaccgatatcgagctcgtcggcggttcccagccg
cgttacctgatggagccgtcgccgttggcaaagctcctccagctcgcggagatctccaaa
tcggatctggtcctcgagatcggctgcgggacaggttacgcctcggccctgctttcgctt
ctcgccggttccgtcgtggcgctggagagcgacgaagccctggccgccacggccacggca
acgctgacacgcctcggttacgacaacgtcgccgtggtgagcggcgatctgaccaaggga
tatgcggcggaagcgccctacgacgtcatcttcatcgacggtgccgtcgagatgctccct
gccgagctgttcgagcagcttcgcgacggcggccggctcgtggccgtggaaggttttggt
aacgcatctcgtgcgaaactttacgtgcgcgaatcgggcatgacgtccgagcgagctgac
ttcaacaccgccgtgaagccgcttcccggcttccgccgcgaccgttcttttgttttttga

DBGET integrated database retrieval system