KEGG   Sinorhizobium meliloti BL225C: SinmeB_1165Help
Entry
SinmeB_1165       CDS       T01884                                 

Definition
(GenBank) Multifunctional protein surE
  KO
K03787  5'-nucleotidase [EC:3.1.3.5]
Organism
smq  Sinorhizobium meliloti BL225C
Pathway
smq00230  Purine metabolism
smq00240  Pyrimidine metabolism
smq00760  Nicotinate and nicotinamide metabolism
smq01100  Metabolic pathways
smq01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:smq00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SinmeB_1165
   00240 Pyrimidine metabolism
    SinmeB_1165
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    SinmeB_1165
Enzymes [BR:smq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     SinmeB_1165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SurE
Motif
Other DBs
NCBI-ProteinID: AEG04091
UniProt: A0A0E0UBU3
Position
1218850..1219620
Genome map
AA seq 256 aa AA seqDB search
MRILLTNDDGIHAEGLSVLERIARTISDDVWVVAPEVDQSGLAHSLTLSEPLRLRPVSER
RFALRGTPTDCVIMAVKKILDRKPDLVLSGVNVGANLADDVTYSGTVAGAIEGTLQGIRS
IALSQAYQHAVGRDVPWDVAETHAPALIRTLMGVDLPDGTLINLNFPNCAVDAVAGVEVT
SQGKLEFGLSIDERTDGRGFPYFWLRFGERAGDFRSGTDIRALRDNRISVTPLKLDMTDH
AAQERIAQALREGSVA
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcctgctgacgaatgacgatggcattcacgccgagggcctctccgtgctggaa
cggatcgcccggacgatatcggacgacgtctgggtggtggcgccggaagtggaccagagc
gggcttgctcattctctgacgctttcggagccgctgcgtctgcgcccggtttccgaacgg
cggttcgcgctccggggcacgccgaccgattgcgtgatcatggcggtcaagaagatcctt
gatcgcaagcccgacctcgtcctttccggcgtcaatgtcggcgccaatcttgctgacgat
gtcacttattccggaacggtggccggcgccatcgagggaacgctgcagggcattcgttcg
atcgcgctcagccaggcctatcaacatgccgtcggccgcgacgttccctgggatgtagcc
gagacgcacgcaccggcgctcatccgcacattgatgggtgtcgacttgccggacggaacg
ctcatcaacctgaactttccgaactgcgccgtcgatgccgttgcgggcgttgaagtcaca
tcgcagggcaagctcgaattcggtctcagcatcgacgagcgcacggacggacgcggcttt
ccctatttctggctccgtttcggcgagcgtgccggcgatttccgttcaggcaccgacatc
agggctctccgcgacaacaggatttcggtaaccccgcttaaactggacatgaccgatcat
gccgctcaggaacgcatcgcgcaggcattgcgggaaggaagtgtcgcttga

DBGET integrated database retrieval system