KEGG   Sinorhizobium meliloti BL225C: SinmeB_2333Help
Entry
SinmeB_2333       CDS       T01884                                 

Definition
(GenBank) Aldehyde dehydrogenase (NAD(+))
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
smq  Sinorhizobium meliloti BL225C
Pathway
smq00010  Glycolysis / Gluconeogenesis
smq00053  Ascorbate and aldarate metabolism
smq00071  Fatty acid degradation
smq00280  Valine, leucine and isoleucine degradation
smq00310  Lysine degradation
smq00330  Arginine and proline metabolism
smq00340  Histidine metabolism
smq00380  Tryptophan metabolism
smq00410  beta-Alanine metabolism
smq00561  Glycerolipid metabolism
smq00620  Pyruvate metabolism
smq00625  Chloroalkane and chloroalkene degradation
smq00903  Limonene and pinene degradation
smq01100  Metabolic pathways
smq01110  Biosynthesis of secondary metabolites
smq01120  Microbial metabolism in diverse environments
smq01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:smq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SinmeB_2333
   00053 Ascorbate and aldarate metabolism
    SinmeB_2333
   00620 Pyruvate metabolism
    SinmeB_2333
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SinmeB_2333
   00561 Glycerolipid metabolism
    SinmeB_2333
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SinmeB_2333
   00310 Lysine degradation
    SinmeB_2333
   00330 Arginine and proline metabolism
    SinmeB_2333
   00340 Histidine metabolism
    SinmeB_2333
   00380 Tryptophan metabolism
    SinmeB_2333
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SinmeB_2333
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SinmeB_2333
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SinmeB_2333
Enzymes [BR:smq01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     SinmeB_2333
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Sugarporin_N
Motif
Other DBs
NCBI-ProteinID: AEG05232
UniProt: A0A0E0UEY9
Position
complement(2404626..2406059)
Genome map
AA seq 477 aa AA seqDB search
MLDKRKFYIDGKWVEPATQNDLLVLNPATEKPIAVISLGTAVDVDRAVAAAKKAFASYSR
TSVEERLALLEKLLAIYKRRYDEMADTITAELGAPRTMSHEQQADVGVGHLQGFIDALKR
LKLREKLPNGDTLLREPIGVCGLITPWNWPVNQIALKVVPALATGCTCVLKPSEFTPLNA
MLYAEMIEEAGFPAGVFNLVNGDGIHAGAALSKHKDIDMMSFTGSTRAGIAVSKDAADTV
KRVTLELGGKSPNIVFADADIEERVTASILECFNNSGQSCDAPTRMLVERSAYDEVVEIA
RRVGMEARVGDPTKVGSHIGPLVSHIQFERVQALIEAGVAEGATLLAGGPGKPEGFETGY
FVQPTIFADVDNSMRIAREEVFGPVLSIIPFDTEEEAIAIANDTNYGLAAYVQTRDRERA
ERVASRLRAGMVHINGGPHRYGSPFGGYKQSGNGREGGMFGLEDFLEVKTVHLPDAA
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacaagcggaaattctacatcgacggcaaatgggttgagccggccacgcagaac
gatcttctggtgctcaatccggcgaccgagaagccgatagcggtcatctcgctcggcacc
gccgtcgacgtcgaccgggcggttgcagccgccaagaaggccttcgcgagctatagccgg
acgagcgtcgaggaacggctggcactgctcgaaaagctgctcgcgatctacaagcgccgt
tacgatgaaatggccgacaccatcacggccgaactcggtgcgcccagaacgatgagccac
gagcagcaggcggatgtgggcgtcggtcatctgcagggcttcatcgatgccctgaagcgc
ctgaaactcagggaaaagctgccgaatggcgacacgctcctgcgtgagccgatcggcgtc
tgcggtctcatcacgccgtggaactggccggtcaaccagatcgcgctcaaggtcgtcccg
gcgcttgcgaccggctgcacctgcgtcctgaaacccagcgagttcacgccgctgaacgcc
atgctctacgccgagatgatcgaggaggcgggcttcccggccggcgtcttcaacctcgtc
aacggtgacggcatccatgccggggcggcgttgtcgaagcacaaggacatcgacatgatg
tccttcaccggttcgacccgggccggtatagccgtcagcaaggacgccgccgatacggtc
aagcgcgtcacgctcgaactcggcggcaagtcgccgaacatcgtcttcgccgatgccgat
atcgaggagcgggtgaccgccagcattctcgaatgcttcaacaattccggccagtcctgc
gatgccccgacacgtatgctcgtcgagcgcagcgcctatgacgaggtcgtggaaatcgcc
aggcgcgtcggcatggaggcgagggtcggcgatccgacgaaggttggctcccatatcggc
ccgctcgtcagccatattcagttcgagcgggtgcaggcactgatcgaagccggcgttgcc
gaaggcgcgaccctgctggccggcggccccggcaagccggaaggcttcgagaccggatat
ttcgtccagccgacgatcttcgccgatgtcgacaattccatgcggatcgcgcgcgaggaa
gtgttcggaccggtgctttcgatcattcccttcgatacggaagaggaggcgatcgcgatc
gccaacgacacgaattacggcctcgcggcctatgtgcagacccgcgaccgcgaaagggcg
gagcgggtggcgtcgcgcctccgggccggcatggtgcacatcaacggcggtccccaccgc
tacggaagccccttcggcggctacaagcagtccggcaacggccgggaaggcgggatgttc
gggctcgaggacttcctggaggtcaaaacggttcacctgccggatgcggcctga

DBGET integrated database retrieval system