KEGG   Sinorhizobium meliloti BL225C: SinmeB_2898Help
Entry
SinmeB_2898       CDS       T01884                                 

Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
smq  Sinorhizobium meliloti BL225C
Pathway
smq00020  Citrate cycle (TCA cycle)
smq00190  Oxidative phosphorylation
smq00650  Butanoate metabolism
smq01100  Metabolic pathways
smq01110  Biosynthesis of secondary metabolites
smq01120  Microbial metabolism in diverse environments
smq01130  Biosynthesis of antibiotics
smq01200  Carbon metabolism
Module
smq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
smq_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
smq_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:smq00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SinmeB_2898
   00650 Butanoate metabolism
    SinmeB_2898
  Energy metabolism
   00190 Oxidative phosphorylation
    SinmeB_2898
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: AEG05795
UniProt: A0A0E0UHQ4
Position
complement(3038789..3039169)
Genome map
AA seq 126 aa AA seqDB search
MNMRTPLGKVRGLGSAKEGTDHFWRQRLTAVASIPLTIFFVVFLAHYAGAPHAELIAALS
NPFVAVTMGLMVVAGLVHMKIGMQVIIEDYVHGEGAKIALLMLNTFFTIAVGGLCLFAVL
KIAFAG
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgcgcacacctctcggcaaggtccggggtctcggttcggcaaaggaaggcacg
gatcacttctggcggcagcgcctcacggccgtcgccagcattcctctcacgatcttcttc
gtcgtctttctcgcccattatgcgggcgcaccgcatgcggaactgatcgcggccctttcg
aacccgttcgtggcggtgaccatgggtctgatggtcgtcgccggcctcgttcacatgaag
atcggcatgcaggtcatcatcgaggactacgtccatggggagggcgccaagatagcgctt
ctcatgctcaacacattcttcacgatcgcggtcggcgggctctgtcttttcgccgtcctg
aagatcgcatttgcagggtaa

DBGET integrated database retrieval system