KEGG   Sinorhizobium meliloti BL225C: SinmeB_3213Help
Entry
SinmeB_3213       CDS       T01884                                 

Definition
(GenBank) NAD-dependent epimerase/dehydratase
  KO
K18981  uronate dehydrogenase [EC:1.1.1.203]
Organism
smq  Sinorhizobium meliloti BL225C
Pathway
smq00053  Ascorbate and aldarate metabolism
smq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    SinmeB_3213
Enzymes [BR:smq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.203  uronate dehydrogenase
     SinmeB_3213
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD NAD_binding_4 RmlD_sub_bind NAD_binding_10 Polysacc_synt_2 NmrA adh_short
Motif
Other DBs
NCBI-ProteinID: AEG06109
UniProt: A0A0E0UHB9
Position
complement(3400752..3401537)
Genome map
AA seq 261 aa AA seqDB search
MTTRLLITGAAGGLGRYAREGLKGCADVLRLSDVATLSPAGEGEEIVRCDLAEREAVDQL
VRGCDAILHLGAISVESDFDALLQANILGTYNLYEAARKAGVNRILFASTNHVTGFHPIG
ETLDHLSPRRPDSLYGVSKCFGEDLSRLYFDKYGMETACLRIGSCFAEPTNRRMLSTWLS
PRDFLALVRRLLDAPKIGHLVLYGVSANRDVWWSNGHADFLGWRPQDSSEPYRHEIEKRE
EEPSDGVRYQGGRHAAAKLPG
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgcgactattgataaccggggccgcgggcggcctcggccgctatgcccgcgag
gggctgaagggctgcgccgatgttttgcgcctttcggatgtcgccacgctttctcccgcc
ggagagggcgaggagatcgtgcgatgcgacctcgccgagcgcgaggcggtcgaccaactc
gtgcgcggttgcgatgcgatcctgcatctcggtgcgatctcggtggagtcagacttcgac
gctcttcttcaggccaacatcctcggcacctacaatctgtacgaggcggcgcgaaaagcc
ggcgtgaaccgcatcctctttgcgagcaccaaccatgtgaccggcttccatcccatcggc
gagacgctcgaccacctgtcgccgcggcggccggacagcctttacggcgtcagcaagtgc
ttcggcgaggacctttcccggctctatttcgacaaatacggcatggaaaccgcctgcctc
aggatcggcagctgcttcgccgaacccaccaaccggcgcatgctctccacctggctgagc
ccgcgtgatttcctggcgcttgtgcgccggcttctcgatgccccgaaaatcggccatctg
gtgctctacggcgtctccgccaaccgcgacgtctggtggtctaacgggcatgcggacttc
ctcggctggcgcccgcaggacagcagcgagccttaccggcacgagattgagaagcgtgag
gaggagccttcggacggcgtgcgctatcagggcgggcgtcatgcggcggcgaagttgccg
ggttga

DBGET integrated database retrieval system