KEGG   Sinorhizobium meliloti BL225C: SinmeB_3266Help
Entry
SinmeB_3266       CDS       T01884                                 

Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
smq  Sinorhizobium meliloti BL225C
Pathway
smq00010  Glycolysis / Gluconeogenesis
smq00052  Galactose metabolism
smq00500  Starch and sucrose metabolism
smq00520  Amino sugar and nucleotide sugar metabolism
smq00521  Streptomycin biosynthesis
smq01100  Metabolic pathways
smq01110  Biosynthesis of secondary metabolites
smq01120  Microbial metabolism in diverse environments
smq01130  Biosynthesis of antibiotics
smq01200  Carbon metabolism
Module
smq_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:smq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SinmeB_3266
   00052 Galactose metabolism
    SinmeB_3266
   00500 Starch and sucrose metabolism
    SinmeB_3266
   00520 Amino sugar and nucleotide sugar metabolism
    SinmeB_3266
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SinmeB_3266
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    SinmeB_3266
Enzymes [BR:smq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SinmeB_3266
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: AEG06161
UniProt: A0A0E0UHR7
Position
3459308..3460327
Genome map
AA seq 339 aa AA seqDB search
MPNASEHSFPFPILIGDIGGTNARFALLTDAYGEPKQLAPIRTGDFATIEEAMQKGILDK
TSVQPRSAILAVAGPIKGDEIPLTNAGWVIRPKDMLASLGLEDVLVINDFEAQALAIAAP
ADQDVVQIGGGAVRPFHSRVVLGPGTGLGVAGLVYAQHTWIPVPGEGGHVDIGPRTERDF
RIWPFLEPIEGRMAGEQILCGRGIMNLYRAVCAANGEEAVLADQAAVTTSALSGADAAAV
ETVSLFATYLGRVAGDMALIFMARGGVFLAGGISQKILPALTKPEFRAAFEDKAPHSALM
RTIPTFAVIHPMAALSGLAAFARTPRDFGVAMEGRRWRR
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgcccaatgcgagtgaacacagctttccctttccgatcctgatcggcgacatcggcggc
accaatgcccgcttcgcactgctcaccgacgcctacggcgaaccgaagcagttggccccg
atcagaacgggcgatttcgccacgatcgaggaggcgatgcagaaaggcatcctcgacaag
acctccgtccagccgcgctcggcgatcctcgccgtggccgggccgatcaagggcgacgag
ataccgctgacgaatgccggctgggtgattcgtccgaaggacatgctggcgagcctcggg
ctggaggatgtgctggtcatcaacgacttcgaggcccaggcgctcgccatcgccgcgccg
gccgatcaggatgtcgttcagatcggcggcggagccgtccggcccttccattcgcgcgtc
gtgctcggcccgggaaccggtctgggcgtcgccggactggtctatgcgcagcatacctgg
atacccgtgcccggcgagggcggtcatgtcgatataggtccccggacggagcgcgacttc
cggatctggcccttcctcgaaccgatcgagggacgcatggccggcgaacagatcctgtgc
ggccgcggcatcatgaatctctatcgcgctgtctgcgccgccaatggcgaggaagcggtt
cttgcggatcaggcggcagtgacgacgagcgcgctctccggcgccgatgcggcggcggtc
gaaaccgtgtcgctctttgcgacctatctcgggcgcgttgccggcgacatggcgctgatc
ttcatggcgcgcggcggcgtattccttgccggcggcatttcgcagaagatactgccggca
ctgacgaagcccgaatttcgcgcggccttcgaggacaaggcgcctcattcggcattgatg
cggacgattccgaccttcgccgtcattcaccccatggcggcgctctccggcctcgcggcc
tttgcccgcacgccgagggacttcggtgttgcaatggagggacgccgttggagaaggtga

DBGET integrated database retrieval system