KEGG   Sinorhizobium meliloti BL225C: SinmeB_4260Help
Entry
SinmeB_4260       CDS       T01884                                 

Definition
(GenBank) NAD-dependent epimerase/dehydratase
Organism
smq  Sinorhizobium meliloti BL225C
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DoxX_3 NAD_binding_10 Epimerase RmlD_sub_bind 3Beta_HSD
Motif
Other DBs
NCBI-ProteinID: AEG08543
UniProt: A0A0E0UQ15
Position
pSINMEB02:868877..870166
Genome map
AA seq 429 aa AA seqDB search
MTRVLVVGASGLIGSAVCAGLHGRGSEIVRVVRPGSAPSSHTAGKALELDLRSVGPEDWL
PHLSGIDAVVNCAGTLQDGPGEDTTAVHARGPASLFKACEQAGVRRVIHFSAMGVDRAQP
SPFSRTKLQGDEALMACDLDWVILRPSVVLGPGAYGASALFRGLAALPWLPVMPNTGLLQ
VVRLEDVVRTVEMFVNPNAPSRLTLEVAGPEALSFKDVVGTYRRWFGWPAARVVNMPTPL
ANLTYKLSDIAGALGWRPPTRSTAQKEIGRGAVGDNRAWVEKTGIEPMALADALARTPVS
VQERWFAKLYLLKPVIFVVLPLFWITTGVISLTSGYEIGVDLMERGGAGVLAGPSVIAGA
LADILIGMAIAFRRTSRIGLYGAVGLSLFYAIAGTALLPELWNEPLGPLLKIWPILVLHL
AALAILEER
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgacgagagtacttgtggtcggcgcctccggcctgatcggctcggccgtgtgcgcaggg
ctccatggccgtggaagcgagatcgtccgcgtggtccggcccggctcggcaccaagctcc
cacacggccggcaaagccctagaactcgaccttcggtccgtcggccctgaagactggctg
ccgcatctctcaggcatcgacgccgtagtaaactgcgcgggaacgctccaggacggtccg
ggggaggatacgacggcagtccatgcccgcggtcccgcctcgctcttcaaggcctgcgag
caggcgggcgtgcgccgcgtcatccacttctcggcaatgggggtcgacagggcccagccc
tcgcccttttcgcgcaccaagcttcagggcgacgaagcgctaatggcatgcgatctcgac
tgggtcatcctgcgcccctccgtcgtgctcggccctggagcctacggcgcaagcgcgctt
ttcaggggcctcgccgcactgccctggctgccggtcatgccgaatactggattgcttcag
gtcgtgcgcctcgaggacgtggtgcgcacggtcgagatgttcgtcaacccgaatgctcct
tcgcggctcactctcgaggttgcgggacctgaggccctgtcgttcaaggacgtggtgggc
acctacaggcgctggttcggatggcccgctgctcgcgtcgtaaacatgccaaccccgctc
gcgaatctcacctacaagctcagcgacatcgccggggctctgggctggcgaccgccgacc
cgcagcaccgcgcaaaaagagatcgggcgcggcgccgtcggcgacaacagggcatgggtt
gagaaaaccgggatagaaccgatggcgctcgcagacgcgctggcgagaacgccggtttca
gtccaggagcgctggttcgccaagctctatctgctcaagcccgtcatcttcgtcgtcctc
ccgctcttctggatcacgacgggcgtcatctcgctcacatcggggtatgaaatcggcgtt
gatctgatggaacggggaggcgccggcgttcttgcggggccgagcgtcatcgccggagcc
ctcgccgacatcctgatcggtatggcaattgcgtttcgccgcacaagccgcatcggcctt
tatggcgcggtcggcctctcgcttttctatgcgatcgccggcacggccctgctcccggaa
ttgtggaacgagccgcttggaccgcttctgaagatctggcccatcctggtgctgcatctc
gctgcccttgctatcctggaggagcgttga

DBGET integrated database retrieval system