KEGG   Sinorhizobium meliloti BL225C: SinmeB_4263Help
Entry
SinmeB_4263       CDS       T01884                                 

Definition
(GenBank) PIN domain protein family protein
  KO
K07064  uncharacterized protein
Organism
smq  Sinorhizobium meliloti BL225C
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PIN
Motif
Other DBs
NCBI-ProteinID: AEG08546
UniProt: A0A0E0UPJ4
Position
pSINMEB02:871047..871490
Genome map
AA seq 147 aa AA seqDB search
MTFLLDVNVLIALIDPSHIGHDDAHEWFASIGQTAWATCPITENGVIRIVGNPEYPNSPG
SPLPAMEIVAKLRSLPGHVFWPDDVSLVGSSDIIPSKILTSGQVTDTYLLALAKARGGKL
ATFDRKLSAAAVTKGNSALHLIATNRS
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
gtgactttcctgctcgacgtcaatgtgctgattgccttgatcgatccgagccatataggc
catgatgatgcgcacgaatggttcgcgtcgattggtcagaccgcgtgggccacctgccca
attaccgaaaatggtgtcatccggatcgtcggcaatcccgagtatcccaattctcccggc
tcaccgttacccgcgatggagatcgtcgccaaattgcggtcgctccccggtcatgttttt
tggccggacgatgtgagccttgtcgggtcaagtgatatcatcccatcgaaaatcctgact
tcggggcaggtgactgacacctatctgcttgcgctcgccaaggcgcgtgggggcaagctg
gcgacattcgatcgcaagctgtcggcagcggcggtcacgaagggcaattccgccttgcac
ctgatcgcgacgaataggtcgtga

DBGET integrated database retrieval system