KEGG   Sinorhizobium meliloti BL225C: SinmeB_4265Help
Entry
SinmeB_4265       CDS       T01884                                 

Definition
(GenBank) 3-oxoacyl-(acyl-carrier-protein) reductase
Organism
smq  Sinorhizobium meliloti BL225C
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR YjeF_N
Motif
Other DBs
NCBI-ProteinID: AEG08548
UniProt: A0A0E0UQ20
Position
pSINMEB02:complement(872513..873343)
Genome map
AA seq 276 aa AA seqDB search
MTGRLKGRSAVITGGLTGQGLAIAEALAAEGANVAVGSFVREAAGRPGDAAAYPDPQEIV
EVRERLAAAGTAVYAGHLDVRDSEAIEQFVSAAEAACGPADILINAAGTTAEQPVAGHSD
ELWLKIIDTNLNGAFRMTRRLLPGMIGRKWGRIINIGSTAATVGWKDNPAYCASKSGLLG
LTRCVALEGAPHGVTCVMISPTWVETELMRRNVQQVVEREGRGRTMEEAMSDIAAQNPQN
RIIQPDEIAALAAFLCGEGARGITMENIQITGGALW
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgacgggcaggctcaagggccgcagtgcggtcatcaccggcgggctgacggggcaggga
ctggcgatcgcggaggcgcttgccgccgagggcgcaaatgtcgccgtaggatcgttcgtc
cgcgaggcggccggccggccgggcgatgccgcggcctatcccgatccgcaggagatcgtc
gaggtccgggagcggcttgccgctgccggcacggctgtttacgcaggtcatctggacgtt
cgcgacagcgaggcgatcgagcaattcgtgtcggcggcggaagccgcatgcggccccgcc
gacattctcatcaatgcagcaggaacgaccgccgagcagccggtggcgggtcattccgac
gagctatggctgaagatcatcgacaccaatctgaacggcgctttccgaatgacgcgccga
ctgctgcccgggatgatcgggcgcaaatggggccgcatcatcaatataggctcgacggct
gccaccgtcggctggaaggacaatccggcctattgcgcctcgaagtcggggctgctcggg
ctcacccgctgcgtagcgctcgaaggggcgccgcatggcgtcacctgcgtgatgatcagc
ccgacctgggtcgaaacggaactgatgcgccgcaacgttcagcaggtcgtcgaaagggag
ggcagggggcggacgatggaggaggcgatgtcggatatcgccgctcagaacccgcagaac
cgcatcatccagcccgacgagatagcggcccttgccgccttcctctgcggcgagggcgca
aggggcatcaccatggagaacatacagatcacgggcggcgcactttggtga

DBGET integrated database retrieval system