KEGG   Sinorhizobium meliloti BL225C: SinmeB_4267Help
Entry
SinmeB_4267       CDS       T01884                                 

Definition
(GenBank) Hydantoinase B/oxoprolinase
Organism
smq  Sinorhizobium meliloti BL225C
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydantoinase_B
Motif
Other DBs
NCBI-ProteinID: AEG08550
UniProt: A0A0E0UQF6
Position
pSINMEB02:complement(873841..876033)
Genome map
AA seq 730 aa AA seqDB search
MLDKTANSLQRRLLESERLMEETGCYDGITELRLRRQDPLKFETLHTKLRAYCVSAREMA
RRISASPGVREVGEMVVAIYTPEGDAIALSNGIMVHVHTMSRFIKWMIRNGYEQNPCIRD
GDIFANNDAFIGTVQVPDVMDVVPIFHKGTLVGWAGAVCHELEAGGITPGGDVCLAQERF
TEGLFVCAEKIGENDEIRRDYVIRCERNLRMPIYWVLDEKAKVAACIDMRESVKQLIDEV
GLEYWQRLSKEFIEEGRRAQLARTRQLTVPGIYRGHTFYGHVTEGKPGFQPLADPNWLYN
IPIEMEITSEGKIRLDFDGTQPWGYHSMNCTPAGMDGGMFVTLTQHMNFEGLVNDGAWMA
TEINIPHGTWTNPDNEMAATATSWALLLPAYGVFQRLLSRGFIARGFVEEAFVGQVNSPM
IEMGGTSQYGTGFGMAHFECAAAGSGALAIKDGLDTAYVGWNPESDMGNIEIWEQNMPMV
YIGRSIVPNSGGAGKYRGGCAFISTWLINNTDHLRLVTSEHSSRVFDNGGLCGGYPAPTC
EKHHAVRNSDIHERAERREPLAHTPGTDPLVSDFERTYKGEQVWEEGPYITRPHKAGDIF
SHAYNGGGGFGDVLERDPIKTAWDVENGFLTREAAEKVFGIILKEDAEGYPQADIDATVA
RRAELRKKRLKQAIPVSEWIAREQRRVEASDFAPEVAKMYRSAMKLSPRFSRDFKEFWGL
ASDFAIAGEN
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atgctggacaaaacggcaaattccctgcagcggcggctgctcgaatccgaacggctgatg
gaagagaccggctgctatgacggcatcaccgaacttcggctgcgcaggcaggatccgctg
aaattcgagaccctccacacgaagctgcgcgcctattgcgtctcggcacgcgaaatggcc
cggcgcatctccgcctcgccgggggtgcgggaagtcggcgaaatggtggtggcgatctac
acgccggaaggcgacgcgatcgcgctttcgaacggcatcatggtgcacgtgcacacgatg
agccgcttcatcaagtggatgatcagaaacggctacgagcagaatccatgcatccgcgac
ggcgacatcttcgccaacaacgacgccttcataggcacagttcaggtgcccgacgtcatg
gacgtggtgccgatcttccataagggcacgcttgtcggctgggcgggcgccgtctgccat
gagctcgaggcgggtggaatcacgcccggcggcgatgtgtgtcttgcgcaggagcgcttc
accgaggggcttttcgtctgcgccgaaaagatcggcgagaatgacgagatccgccgggat
tacgtaatccggtgcgagcgcaatctgcgcatgccaatctactgggtgctggacgaaaaa
gccaaggtcgccgcctgcatcgacatgcgcgagagcgtaaagcaactcatcgacgaggtc
ggcctcgaatattggcagcggctttccaaggaattcatcgaggagggaagaagagcacag
cttgcccgcacgcggcagttgaccgtgcccggcatttatcgaggccacaccttctacggt
cacgtgaccgaaggcaagccggggttccagccgctcgccgacccgaactggctgtacaat
atccccatcgagatggagatcaccagcgagggcaagatcaggctcgacttcgacggcacg
cagccctggggctatcattcgatgaactgcaccccggccggcatggacggcggcatgttc
gtgacgctcactcagcacatgaacttcgaggggctggtcaatgacggcgcctggatggcg
accgagatcaatattccgcatggcacctggaccaacccggacaacgagatggcggccaca
gccacctcgtgggccttgctgctgccagcgtacggcgttttccagcggctgctctcacgc
ggtttcatcgcgcggggctttgtcgaggaagcctttgtcggtcaggtgaactctccgatg
atcgagatggggggcaccagccagtacggcaccggcttcggcatggcgcatttcgaatgc
gcggccgcgggctccggagcgctggcgatcaaggacgggctcgacactgcctatgtcggc
tggaacccggaatcggacatgggcaatatcgagatttgggaacagaacatgccaatggtc
tatatcggccgctcgatcgtgccgaattccggcggcgccggaaagtaccgcggcggctgc
gcctttatctcgacctggctcatcaacaataccgatcacctgcgcctcgtaacatctgag
cattcctcgcgcgtgttcgacaatggcggcctgtgcggcggctatccggcaccgacctgc
gagaaacatcacgcggtgaggaactccgatattcacgagcgcgccgaacgccgggagccg
ctcgcacatacgccgggcaccgacccgctggtctcggatttcgagcgcacctacaaaggc
gagcaggtctgggaggagggtccctacatcacccggccccacaaggccggcgacattttc
agccacgcctataatggcggtggcggcttcggcgacgtgctggaacgcgacccgatcaag
acggcatgggacgtggaaaacggcttcctgacgcgcgaagccgccgagaaggtgttcggc
atcatcctgaaggaggatgccgagggttatccgcaagccgacatcgatgcgaccgtcgcc
cgccgcgcggaactgcgcaagaagcggctgaagcaagccattccggtatcggagtggatc
gccagggagcaacggcgcgtggaggcttcggacttcgcgcctgaggtcgccaaaatgtat
cggagcgcgatgaagctctcgccgcgcttttccagagacttcaaggaattctggggcctt
gcctccgatttcgccattgccggggagaattga

DBGET integrated database retrieval system