KEGG   Sinorhizobium meliloti BL225C: SinmeB_4276Help
Entry
SinmeB_4276       CDS       T01884                                 

Definition
(GenBank) metallophosphoesterase
Organism
smq  Sinorhizobium meliloti BL225C
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Metallophos_2
Motif
Other DBs
NCBI-ProteinID: AEG08559
UniProt: A0A0E0UPP6
Position
pSINMEB02:complement(884503..884997)
Genome map
AA seq 164 aa AA seqDB search
MIYFTGDTHFGDPRVLRIDRRPFSNMAEHDAALIANWNETVSPQDEVWHLGDFAAKRNGL
AEDILSRLNGRKHLIVGNNDPNDTTGAGGWHSVQHYAELMVDGRLLVLCHYPFRTWNQMG
KKSINLHGHSHGRLKPMPRQFDVGVDARGLRPVSLVDILPQSAR
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgatctatttcacgggcgacacgcatttcggcgacccgcgtgtgcttcgcatcgaccgc
cgtccattttccaacatggccgagcatgatgccgccctgatcgccaattggaacgaaacc
gtctcgccgcaggacgaggtctggcaccttggcgacttcgcggcaaagagaaacgggctt
gccgaagatattctgtcccggctgaacggccgcaagcatctgatcgtgggcaacaacgat
ccgaacgacacgaccggggcgggcggctggcacagcgtgcagcattatgcggagctgatg
gtggatgggcggctgctcgtcctttgccattatccgttccggacctggaaccagatgggg
aagaagtcgatcaacctgcacggccattcccacggcaggttgaagccgatgccacggcag
ttcgatgtgggggtggatgcgagaggcctgcgtccggtcagcctggttgatattctcccc
caatccgcgcggtag

DBGET integrated database retrieval system