KEGG   Sinorhizobium meliloti BL225C: SinmeB_4280Help
Entry
SinmeB_4280       CDS       T01884                                 

Definition
(GenBank) type III effector Hrp-dependent outer protein
Organism
smq  Sinorhizobium meliloti BL225C
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1537 DUF1357_C
Motif
Other DBs
NCBI-ProteinID: AEG08563
UniProt: A0A0E0UQ35
Position
pSINMEB02:complement(889043..890371)
Genome map
AA seq 442 aa AA seqDB search
MHIPLLSYYGDDLTGSTDVMEALSSQGVETALFLKVPEPSLFERFARCRAFGLAGTSRSQ
TPGWMAENLPPAFLWLKALKAEIAHYKVCSTFDSSPGVGNIGKAIEIGRDVFGAAPVPLV
IGAPQIRRYTAFGNLFAAFRGETYRIDRHPVMSRHPVTPMNEADIRLHLSRQTSLSAALV
DLVQLASPDVDAFADRALADHQLVLLDVADEGSQAVVGRQLWRTRTAEGQFVCGSSGIEY
ALVREWRRLGLIGEAPAFAPPGPVDRIAVVSGSVSPTTERQIRHALQNGFDGIALDAVAL
AATDAGSALEDAVARGLASLEKGRSVLLYTALGPSADRGDAIPVEDGSRHRIGERLGSLL
RELVTRAGLRRAVVAGGDTSSHALGQLSVDALTLRLPLPQSPGSPLCTAHSADPRVDGME
VALKGGQVGLDDYFSMIRDGRA
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgcacattcccctgctcagctactacggcgacgatctgaccggctcgaccgacgtgatg
gaggcactctcctcccagggcgtcgaaaccgcgttgtttctcaaggtgcccgagccttcg
ctcttcgagcgcttcgcccgttgccgcgcctttgggctcgcgggcaccagccgcagccag
acgccgggctggatggcggaaaaccttccgccggcctttctgtggctgaaggcgctgaag
gcggagatcgcccattacaaggtctgctcgaccttcgattcgagccccggtgtcggcaac
ataggcaaggcgatcgagatcggacgggatgtcttcggcgccgcaccggtaccgctcgtc
atcggcgcaccgcagatccgtcgctacaccgccttcggcaatctcttcgccgcctttcgc
ggcgaaacctatcgcatcgatcgccatccggtgatgagcaggcatccggtaacccccatg
aacgaggcggatatccgccttcacctttcgcgtcagacatcgctcagcgcggctcttgta
gatctcgtgcaactcgcgtcgccggacgtggacgcgttcgccgacagggctctcgcggat
caccaactcgtccttctcgatgtcgcggatgaggggagccaagccgtcgtcggacggcag
ctctggcggacgcgaacggccgaagggcaattcgtctgcggctcgtccggcattgaatat
gcactcgttcgcgaatggcgtcgccttggcctgatcggcgaagcgccggcattcgcgccg
cctggaccggtcgaccggatcgcggtggtttccggcagcgtctctccgacgacggagcgg
caaatccgtcatgcgctccagaacggtttcgacgggatcgcgctcgatgcagtcgcactc
gcggcgacggatgccggctcggcactcgaggatgccgtcgcgcgcgggctggcctctctg
gagaagggccggagcgttcttctctacaccgcgctcggcccctctgccgatcggggcgat
gccattcctgttgaggatggctcgcgccaccggatcggtgaacggctcggatcgctcctg
agagagctggtgacgcgcgccgggctccgccgcgctgtcgtcgccgggggagatacgtcg
agccacgcccttggccagctctctgtcgacgcgcttacattgcggctgccgcttccgcag
tcgccgggctcccccctctgcaccgcgcatagcgccgatcccagggtggacggcatggag
gtcgctctcaagggcggtcaggtcggcctcgacgactatttttcgatgatccgggatgga
cgggcctaa

DBGET integrated database retrieval system