KEGG   Sinorhizobium meliloti BL225C: SinmeB_4285Help
Entry
SinmeB_4285       CDS       T01884                                 

Definition
(GenBank) diguanylate cyclase with GAF sensor
Organism
smq  Sinorhizobium meliloti BL225C
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GGDEF GAF_2 GAF_3 GAF
Motif
Other DBs
NCBI-ProteinID: AEG08568
UniProt: A0A0E0UQ40
Position
pSINMEB02:896183..897226
Genome map
AA seq 347 aa AA seqDB search
MGQAVRMPTNERQRLLAVRSLNSIGSAPTPELATLAELAKGIFDVSYAAINIIDEDWQRI
AGQAGFRIGECSREMSICTRVVFADELLIVPDLAEDRELKTRPYVVGSPHFRFYAGTPVY
LENLPVGSFCILDVRPRHLSDGQAQNLRRFAAVASALLSLQKANLVMGLAHNQLQNAAIT
DPLTGLFNRSALSSIVDGALHNAIAAGQTFGALYLDMDGFKAINDELGHHAGDEVLYEAA
NRIRSVIRAGDIAIRMGGDEFAVFIPNPPNAPALAAVSQRLVAAFREPFQVDGKAVLARI
SIGGALAPLNGQRRAELLNSCDKALYSAKRDGRDRFVILDALRRQRQ
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgggacaagccgtacgaatgcccacgaacgaacgtcaaaggttgctcgcagtccgttcg
ctcaattcaatcggcagcgctcccacgcccgaactcgcgaccctggccgagcttgccaaa
ggcatcttcgacgtttcttacgccgccatcaacatcatcgacgaagactggcagcggatc
gccggtcaggcgggcttcaggatcggcgaatgctcgcgcgagatgtccatatgcacgcgg
gtcgtcttcgcagacgaactcctcattgtcccggacctggcggaagaccgtgagctgaag
acgagaccatatgtggtcggaagcccgcacttccgcttttacgccggcacgcccgtctat
ctcgagaacctgcccgtcggcagcttctgcatcctcgatgtccggcccaggcatctttcc
gacgggcaggcgcagaacctgcgccgatttgcggctgtcgccagtgcgcttttgagcttg
cagaaggcaaatctcgtgatggggctcgcccataaccaactacagaatgcggccattacc
gatccgttgaccggcctgttcaaccgctcggccctgtcgtcgatcgtcgacggggctctc
cacaacgccatcgccgcgggtcagaccttcggcgctctttatctcgacatggatggtttc
aaagcgatcaacgacgagcttggccatcacgccggcgacgaggttttgtacgaagccgcc
aaccgaattcgctcggtcatcagagcaggcgatatcgcgatccgcatgggcggcgacgaa
ttcgccgttttcattccaaatccgcccaacgcaccggccctggcagcggtctcgcagcgg
ctggtagcggcctttcgcgaacccttccaggtcgacggcaaggcggtccttgcacgcatc
agcatcggcggcgcccttgccccgctcaacgggcagcgacgagcggagctgctgaacagc
tgcgacaaggctctctactcggcaaagcgtgacggccgcgaccggttcgtcatcctcgac
gccttacggagacaacgacaatga

DBGET integrated database retrieval system