KEGG   Sinorhizobium meliloti BL225C: SinmeB_4287Help
Entry
SinmeB_4287       CDS       T01884                                 

Definition
(GenBank) transcriptional regulator, IclR family
Organism
smq  Sinorhizobium meliloti BL225C
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IclR HTH_IclR MarR_2 GAF SMC_Nse1 AbiEi_4 HTH_20
Motif
Other DBs
NCBI-ProteinID: AEG08570
UniProt: A0A0E0UQH6
Position
pSINMEB02:898591..899310
Genome map
AA seq 239 aa AA seqDB search
MSVRPLSSVLKTLAAFECIAAAPEPLRLVGIARQLGEARGAAHQRLVTLVEAGWIEQTPD
GRYRLTLRIVGHAAMALEQSNLGVRFAGVLEEMVTESGETASLAVLDGKSAVIVRRVESR
GVLRADLRIGTQLRLDRTAFGRVLVSFSRPEIVDRLRAQGVELPDDETITGVRKCGYAIS
EVEGPRTVSAVAAPIIDAQGECIGALALSGPFTGFDTDKCARIVVAAAAASAARLRGEQ
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgtcggttcgccccttatcatcggtgctcaagaccctcgcagcgttcgagtgtatcgcc
gcggcaccggagccgttgcgcctcgtcggcatcgcgcgccaactcggcgaagcgcggggt
gcggcccatcagcgcctcgtcactctggtggaagccggatggatcgagcagacgcccgac
ggccgctatcgtttgacgcttcgcatcgtcggacacgcggccatggcgctcgaacaatcc
aatctcggcgtgcgctttgcaggcgtcctggaagagatggtcacggagagcggtgagacc
gcctcgctcgccgttctcgacggaaaatccgccgtcatcgttcggcgggtcgagtcgcgc
ggcgtccttcgcgcggaccttcggatcggaacgcagctccgcctcgatcgcaccgccttc
ggtcgggtgctcgtatcgttctcgcgtccggaaatagtcgaccggctgagggcgcagggc
gtcgaactgccggatgacgagaccatcaccggggtgcgcaagtgcggctacgccatttcg
gaggtcgaggggccacggaccgtatcggcggtcgccgccccgatcatcgatgcgcagggc
gaatgcatcggcgcgcttgcgctttccggcccgttcacaggtttcgatactgacaagtgc
gcccggatcgtcgtcgcagcagcggcggcaagcgccgcgcgcctgcgaggagaacaatga

DBGET integrated database retrieval system