KEGG   Sinorhizobium meliloti BL225C: SinmeB_4295Help
Entry
SinmeB_4295       CDS       T01884                                 

Definition
(GenBank) Adenosylmethionine--8-amino-7-oxononanoate transaminase
  KO
K16871  4-aminobutyrate---pyruvate transaminase [EC:2.6.1.96]
Organism
smq  Sinorhizobium meliloti BL225C
Pathway
smq00250  Alanine, aspartate and glutamate metabolism
smq00650  Butanoate metabolism
smq01100  Metabolic pathways
smq01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:smq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SinmeB_4295
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SinmeB_4295
Enzymes [BR:smq01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.96  4-aminobutyrate---pyruvate transaminase
     SinmeB_4295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AEG08578
UniProt: A0A0E0UQ49
Position
pSINMEB02:906837..908222
Genome map
AA seq 461 aa AA seqDB search
MNDRPNSLHALDKQSLVHPYTNLAVHQETGPHVITGGDGIYVVDDEGKRYIEGLAGLFCA
GLGFSEQRLVEAATRQLKTMPFYHSFAHKSTEPGIRLAEKLLSIAPVPMSKVFFAGSGSE
ANDTAIKLIWYYNNALGRPEKKKIISRRKAYHGVTVATASLTGLPFNHRDFDLPIANILH
TDCPHYWRFAETGETEEDFATRMANNLEAIILEEGPETIAAFFAEPVMVSGGVITPPKTY
FEKVQAVLRKYDILLIADEVICGFGRTGNMFGSETYGLKPDMISCAKQLSAAYMPISALM
INEKIADALVDQSRKIGTFSHGFTYGGHPVAAAVALEALTIYEEIDIVGHVRSVAPAFQD
RVRKLGEHPLIGEARGVGLVAGLEFVKDKATRENFPPAWQVANQAGKFATARGVLTRGLG
DMVSLCPAMIIDDEQVDDLMTRMGLALDDTLAWARAQGHVG
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaccgtccgaattccctccacgctctcgacaagcagagcctcgtccacccctac
acgaacctggccgtgcatcaggaaaccgggccgcacgtgatcaccggcggcgacggcatc
tatgtcgtcgacgacgaaggaaaacgctacatcgagggattggcaggcctgttctgcgcc
ggtctcggcttcagcgagcagcgcctcgtcgaagccgcgacgcgtcagctcaaaacgatg
cccttctatcattccttcgcccataaatcgacggagccgggcatcaggcttgcggagaag
ctcctgtcgatcgcgccggtcccgatgtcgaaggtgttcttcgccggctccgggtcggag
gcgaacgacacggcgatcaagctcatctggtactacaacaacgctctcgggcgtcccgag
aagaagaagatcatctcgcgccgcaaggcctatcatggcgtcaccgtcgcgaccgcgagc
ctcaccggcctgccgttcaaccaccgcgatttcgatctgccgatcgccaacattctccat
accgattgcccgcactactggcgcttcgccgagaccggggaaacggaggaagacttcgcc
acgcggatggccaacaatctcgaggcgataatcctcgaagagggtccggaaacgatcgcc
gcctttttcgccgagcccgtcatggtttcaggcggcgtcatcaccccgccgaaaacctat
ttcgaaaaggtccaggcggttctccgcaaatacgatatcctgctcatcgccgacgaggtg
atctgcggttttggccgcacaggcaacatgttcggctcagaaacctacgggttaaagccg
gacatgatcagctgcgccaagcagctgtcggcggcctacatgccgatctccgccctgatg
atcaacgagaagatcgctgacgcacttgtcgaccagagccggaagatcggcactttctcg
cacggtttcacctatggcggccatccggttgcagccgccgtggcgctcgaagcgctgacg
atctacgaggagatcgacatcgtcggccatgtacgctccgtcgcccccgctttccaggat
cgcgtgcgtaagctcggcgagcatccgctgatcggggaagcgcgcggcgtcggcctcgtc
gccggcctcgaattcgtcaaggataaagcgaccagggagaatttcccgccggcttggcag
gtggcaaaccaggccggcaagttcgcgaccgcccgcggcgtcctgacacgcggcctcggc
gacatggtgagcctctgccccgcgatgatcatcgatgacgagcaggtcgacgacctgatg
acgcgcatggggctggcgcttgacgatacgctggcctgggcacgcgcgcagggacatgtc
ggctga

DBGET integrated database retrieval system