KEGG   Sinorhizobium meliloti BL225C: SinmeB_4304Help
Entry
SinmeB_4304       CDS       T01884                                 

Definition
(GenBank) Phosphonate-transporting ATPase
  KO
K09810  lipoprotein-releasing system ATP-binding protein [EC:3.6.3.-]
Organism
smq  Sinorhizobium meliloti BL225C
Pathway
smq02010  ABC transporters
Module
smq_M00255  Lipoprotein-releasing system
Brite
KEGG Orthology (KO) [BR:smq00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SinmeB_4304
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:smq02000]
    SinmeB_4304
Enzymes [BR:smq01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.-  
     SinmeB_4304
Transporters [BR:smq02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Lipoprotein-releasing transporter [MD:M00255] [OT]
    SinmeB_4304
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_16 AAA_29 AAA_25 AAA_22 IstB_IS21 RsgA_GTPase RNA12 AAA_30 AAA_23
Motif
Other DBs
NCBI-ProteinID: AEG08587
UniProt: A0A0E0UPJ9
Position
pSINMEB02:complement(914874..915554)
Genome map
AA seq 226 aa AA seqDB search
MSPLIEARGLTRILHETVPVTLVKDIDLIIEEGEFVAVTGPSGSGKSSLLYLLGLLDRPT
EGRLRVRGRDTEPMSEKERAETRLATMGFVFQFHFLLPEFTARENVEIPMRKLARLGRDE
MRARATDLLCSLGLADHLDKRPDQLSGGQRQRVAVARALANDPPLILADEPTGSLDSRSS
EQVFAILDGLVRERGKTVVAVTHDLDMAARMDRRIHLVDGEVSKEE
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgagtccgctgatcgaggctcgcggcctcacgcgtatattgcatgagacggttccggta
acgctggtgaaggacatcgatctcatcatcgaggaaggcgagttcgtggccgttaccggc
ccttcggggtcgggaaagtcgtcgctgctctatctcctggggctgctcgaccggccgacg
gagggtaggctgcgcgtccgcggccgcgataccgagccgatgagcgagaaggagcgggcg
gagacccgcctcgctaccatggggttcgtcttccagttccatttcctcctgccggaattt
accgcgcgcgagaacgtcgagattcccatgcgcaagctcgcccgcctcgggcgcgacgag
atgcgggcgcgggcgaccgacttgctgtgctcgctcggcctcgccgatcatctcgacaag
cggccggatcagctctcgggcggccagcgccagcgcgtggcggtcgcacgggcgcttgcc
aacgatccgccgctgatcctggcagacgagccgaccggaagcctcgacagcaggagttcg
gagcaggtattcgcaattctcgacggacttgtccgcgagcgcggcaagacggtcgtcgcg
gtgacgcacgacctggacatggctgctcgaatggaccggcgaatccacctcgtggacggc
gaggtcagcaaggaagaatag

DBGET integrated database retrieval system