KEGG   Sinorhizobium meliloti BL225C: SinmeB_4309Help
Entry
SinmeB_4309       CDS       T01884                                 

Definition
(GenBank) extracellular solute-binding protein family 1
  KO
K02012  iron(III) transport system substrate-binding protein
Organism
smq  Sinorhizobium meliloti BL225C
Pathway
smq02010  ABC transporters
Module
smq_M00190  Iron(III) transport system
Brite
KEGG Orthology (KO) [BR:smq00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    SinmeB_4309
Transporters [BR:smq02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Iron(III) transporter [MD:M00190] [OT]
    SinmeB_4309
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_6 SBP_bac_8 SBP_bac_11 SBP_bac_1 NMT1
Motif
Other DBs
NCBI-ProteinID: AEG08592
UniProt: A0A0E0UPK4
Position
pSINMEB02:920326..921354
Genome map
AA seq 342 aa AA seqDB search
MGLVKLAAAALAAGATFFAFSARADGNLNLICSADVVICEQMKGAFEKKTDISVNMVRLS
SGETYAKIRAEARNPKTDIWWAGTGDPHLQAASEGLTLEYKSPMLGELHEWAVKQAESAG
YRTVGVYAGALGWGYNTEIFKQKNLKEPKCWADLLDPSFKGEVQIANPNSSGTAYTALAT
LVQIMGEDEAFDYLKKLNANVSQYTKSGSAPVKAAARGETAIGIVFMHDAVAQTVEGFPV
KSVAPCEGTGYEIGSMSIIKGTKNLDNAKKWYDWALSADVQSSMKEAKSFQLPSNKTAKV
PEEAPKFEDIKLIDYDFKTYGDPAKRKELLERWDREIGAAAN
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgggtttggttaaactggccgcggcagcgctcgccgcgggcgcgacgttctttgccttt
tccgcgcgagccgatggaaatctcaatctgatttgctcggccgacgtggtgatctgcgag
cagatgaagggcgctttcgaaaagaagaccgacatctccgtcaacatggttcgcctgtct
tcgggcgaaacctacgcgaagatccgggccgaggcgcgcaaccccaagacggacatctgg
tgggcgggcaccggcgacccgcatctgcaggccgcctccgagggactgacgctcgaatac
aagtcgccgatgctcggtgagctgcatgaatgggccgtcaagcaggccgagagcgccggc
tatcggacggtcggcgtctatgccggcgcgctcggctggggctacaacacagagatcttc
aagcagaagaacctgaaggagccgaagtgctgggcggacctgctcgatccgtccttcaag
ggtgaagttcagattgccaatccaaattcttccggcaccgcctatacggcgctcgcaacg
ctcgttcagatcatgggcgaggacgaggctttcgactatctgaagaagctgaacgcaaac
gtgtcgcaatacacgaagtccggctccgcaccggtgaaggccgcggcgcggggggaaacc
gcaatcggcatcgtgttcatgcacgatgcggtcgcgcagacggtggaaggcttcccggtg
aagtccgtggcgccctgcgaaggcaccggctacgaaatcggctcgatgtcgatcatcaaa
ggcacaaagaacctcgacaatgccaagaaatggtatgactgggcgctctccgccgacgtg
cagtccagtatgaaggaggcgaaatcgttccagcttccttccaacaagacggccaaggtg
ccggaagaggcgccgaagttcgaggacatcaagctgatcgattacgacttcaagacttac
ggcgatccggccaagcgcaaagagctcctggagcgctgggaccgggagatcggcgcagcc
gcgaactga

DBGET integrated database retrieval system