KEGG   Sinorhizobium meliloti BL225C: SinmeB_4315Help
Entry
SinmeB_4315       CDS       T01884                                 

Definition
(GenBank) hypothetical protein
Organism
smq  Sinorhizobium meliloti BL225C
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALIX_LYPXL_bnd TMF_TATA_bd DUF5132
Motif
Other DBs
NCBI-ProteinID: AEG08598
UniProt: A0A0E0UQ68
Position
pSINMEB02:complement(927427..928722)
Genome map
AA seq 431 aa AA seqDB search
MALGASQRLHDGVAAVETMTRFALAVLALASGVYTYLGVRSILDGSPTSVFFAAIIYSSS
VSVGIYAFWSYMARFYPHVTNHTGRAAMLGVMALGAAMIIAMSSWLNAAALAGSAALEQH
LAETVEDYTADLDQAHQNALAAQSLLPDIQRASERFAQLAASERQSGALTGTTGSGSVVQ
LLSQMSAQMKDLENGINASREQVAMLFNQGQKRLETMRTLVSAPGAVAPRADQFSSEVVA
LTGVITSLGQTSIAPSIRRAADDLSLGFIAPVADGGDADLVNRQDRVMETVRASVATQSK
VLSEAADEILARAPVAERRFVPLSSAEAVLRYATDFIPAWAGAISIDLLPGVLVFILAAV
HSAIRKQEEKLPFAERITAAELLQALEVQRAVTANGGQLGDIVAQAEAEEPNNITSLDPR
TRAKDRTHEDR
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggccctcggcgcatcccaacgtttgcatgacggcgttgcggccgtggaaactatgacg
cgctttgcacttgcggtgctggcgcttgcctcgggcgtctatacctatctcggcgttcgc
agcattctcgacggctccccgacctcggtcttcttcgcggcgatcatctactcgtcctcg
gtttccgtcggcatctacgccttctggtcctacatggcgcgcttctatccgcatgtgaca
aaccatacgggccgagccgccatgctgggcgtgatggctttgggggcggccatgatcatc
gccatgtcgagctggctcaatgcggcggcgctcgcaggttcggccgcgctcgaacagcat
cttgcggaaacggtggaggattataccgccgacctggaccaggcgcatcagaacgcgctt
gcggcccagagcctgctgcccgatatccagcgcgcatccgaacgcttcgcccagcttgcc
gcctcggagcggcaatcgggagcgctcaccggcacgacgggatccggaagcgtagtgcag
cttctgtcgcaaatgtcggcacagatgaaggatctggagaatggcataaacgcgtcccgc
gaacaggtggcgatgcttttcaaccagggacagaagcggctcgaaacgatgcggacactg
gtctccgcgccgggtgcggtcgcaccgcgtgccgatcagttctcctcggaagtggtggcg
cttacgggcgtcataacgtcgctcggacagacttcgatcgcgccttcgatccgccgcgcc
gcagacgacctgtcgctcggcttcatcgcacccgtggccgacggcggcgatgccgatctc
gtcaaccgccaggaccgagtgatggagactgtgcgagcctcggtggcaacgcaatccaag
gttctctccgaagcggctgacgaaatactggcgcgtgcgccggtggcggagcggcgtttc
gttccgctttcatccgctgaggcggtactgcgctatgcgaccgatttcattcccgcctgg
gcgggcgccatttccatcgacctgctgccgggcgtactggtcttcattctggcagcggtt
cacagcgcaatccgcaagcaggaggagaagctgccctttgccgagcgcatcacggcggcc
gagcttctgcaggccttggaagtgcagcgcgccgtgacggcgaacggcgggcaactcggc
gatatagtcgctcaggcagaagcggaggagccgaacaacatcaccagcctcgacccgagg
acgcgtgcaaaggatcggacgcatgaggatcgatga

DBGET integrated database retrieval system