KEGG   Sinorhizobium meliloti BL225C: SinmeB_4316Help
Entry
SinmeB_4316       CDS       T01884                                 

Definition
(GenBank) adenylate/guanylate cyclase
Organism
smq  Sinorhizobium meliloti BL225C
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_cyc Response_reg HisKA
Motif
Other DBs
NCBI-ProteinID: AEG08599
UniProt: A0A0E0UPT7
Position
pSINMEB02:complement(928839..930401)
Genome map
AA seq 520 aa AA seqDB search
MTAGNDFQHQAIAAHVAQRLAGPARAILGFQELLVEQARDLGLIHIKGDLDRIGAAARQL
NGFIDRLLEGAACPLEEGEAEAEARLRHDLRTPLNAIIGYSEMILEEASDAPEHALKEDL
HVILSAAAELLTQVDAIASLSRGETVEMLQPGERAEIDAAGLERLLFKAQEVACPEQGGR
ILVVDDVASNRDLLSRRLRREGHRVVTAESGLSALARLAEDEFDLILLDILMPDMNGIEM
LSRLKSEERWQHVPVIMISGLSDVTAVARCIEAGADDYLTKPFNPILLRARINSTLEKKR
WLDREHRYLQQIKTEKLRADSLIRAILPDQIVARLQDGEEIIADRFDEVSILFADIVGFS
PIAARLTASDLVRRLDRMFRRFDLLTEQHRVEKIKTIGDAYMAACGIPEPAPDHADRIVA
LGKSMLRSLQDMEAGPDRFRVRIGIHTGPVVAGLIGRLRFVYDVWGETVNIASRLESQGV
ADVIQISEATRRALRGPWTLERRCALELRGIGAVETYLVR
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccggcaacgacttccagcaccaggcgatcgccgctcacgtggcccagagattg
gccggtccggcgcgggcaatcctgggtttccaggaactgctggtcgagcaggcgcgggat
ctcggtttgatccatataaagggcgatctcgaccggatcggtgctgcagcacggcaactg
aacggctttatcgatcgccttctcgagggcgcggcctgccctctggaggaaggagaagcg
gaggctgaggcaagactccgccacgacctgcgcacgccgctcaacgccatcataggctat
tccgaaatgatccttgaagaggcaagcgatgcgccggagcatgcgctaaaggaagacctc
catgtgatactgtcggcggcggcagagctcctgacgcaggtcgacgccatcgccagtctt
tcacgcggggaaacggtcgagatgcttcaaccgggggaacgcgccgaaatcgacgcggcg
gggctcgagcgacttctgttcaaggcgcaagaggttgcatgcccggaacaagggggcagg
atcctcgtcgtcgacgacgtggccagcaatcgtgatcttctgtcccggcggctgcgacgc
gaaggtcaccgcgtggtcaccgccgaatccggactgtctgcgctagccagattggccgag
gacgagttcgacctcatcctgctggacattctgatgccggacatgaacggcatcgagatg
ctgtcgcgattgaagtccgaggagcgatggcagcacgtcccggtcatcatgatatcgggc
ttgagtgatgtcacggcggtagcccgctgcatcgaggccggcgccgacgactatctgacg
aagcctttcaatccgatacttctgcgcgcacggatcaactcgacgctcgagaagaagcgc
tggcttgaccgggagcaccgctacctccagcagataaaaacggaaaagctgcgggcggat
tccctcattcgcgcgatcctgcccgaccagatcgttgcacggttgcaggatggcgaagag
atcatcgccgaccgcttcgacgaggtctccatcctctttgcggatatcgtcggcttttcg
cccattgcagcaaggttgactgcatccgatctggtcaggcgcctggacagaatgtttagg
aggttcgatctgctgaccgagcagcaccgtgtcgagaagatcaagaccataggagacgcc
tatatggccgcctgcgggatcccggagcctgcgccggatcatgccgacaggatcgtggct
ctcggaaagtccatgcttcgatccttgcaggacatggaagccgggcctgaccgttttcgg
gttcggatcggaatccatacggggcccgtcgtagccgggctgatcgggcgactccggttc
gtctacgacgtgtggggagaaacggtgaacatagcgagcaggctcgaatcccagggggtc
gccgacgtaatacagatttccgaggcaaccaggcgcgcgctgcgcggtccgtggacgctc
gagcgccgttgcgccctggagctgcgaggcatcggcgcggtggagacctatcttgttcga
tga

DBGET integrated database retrieval system