KEGG   Sinorhizobium meliloti BL225C: SinmeB_4319Help
Entry
SinmeB_4319       CDS       T01884                                 

Definition
(GenBank) hypothetical protein
Organism
smq  Sinorhizobium meliloti BL225C
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3365 Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: AEG08602
UniProt: A0A0E0UPL4
Position
pSINMEB02:complement(933550..934308)
Genome map
AA seq 252 aa AA seqDB search
MEALAALARNCIVTLLCGCALFAPSLAAEEADDVATGTRLAELLRAARNVLSNYQSLIND
PALGDKKLDGERFTAEAIALYGERTGHPLVSDDLGDRDRKLLQAQVEAMREVVNEQQDDI
NRPGIGFKGFVPAIFARLMNEKFAVKAGNEALVRVTAPEVLVRNRKSLPDAWEARVINEV
FSDPQRPKGELYTEVTQVNGRPAFRMLLPEYYTESCLSCHGSPKGEIDVTGYPKEGGKAG
DLGGAISIVLFK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atggaagctcttgcagccctggcgcgaaactgcatcgtcacgctgttgtgcggttgcgcg
ctcttcgcaccttcgcttgctgccgaggaggccgatgatgtcgcgaccgggacgcggctt
gccgagctgttgcgtgccgctcgaaacgtcctttcgaattaccagtcgctcatcaatgac
ccggccctcggagacaagaaactcgacggtgagcgtttcacggccgaagcgatcgccctt
tatggcgagcgcaccggccatccattggtctcggatgatctcggcgatcgcgaccgcaag
cttttgcaggcgcaggtcgaggcgatgcgggaagtcgtgaatgagcagcaggacgacata
aaccgccccgggatcgggttcaaaggtttcgtgccggccattttcgcgcgtctgatgaac
gagaaatttgccgtcaaggcgggcaatgaggcgctggtccgcgttacggcgccggaggtt
ctggtgcgcaaccgcaagtcgcttcccgatgcctgggaggcgcgagtcattaacgaggtc
ttctcggatccgcagaggccgaagggtgaactctatacggaagtgacgcaggtgaacggc
cgcccggctttccggatgctgctgccggaatattacacggagtcctgcctttcctgtcac
ggctcgccgaagggtgaaatcgacgtcaccggctatccgaaggaaggcggcaaggcgggc
gatctgggcggtgccatcagcatcgtcctgttcaaatga

DBGET integrated database retrieval system