KEGG   Sinorhizobium meliloti BL225C: SinmeB_4321Help
Entry
SinmeB_4321       CDS       T01884                                 

Definition
(GenBank) oxidoreductase domain protein
Organism
smq  Sinorhizobium meliloti BL225C
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GFO_IDH_MocA GFO_IDH_MocA_C NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AEG08604
UniProt: A0A0E0UPU0
Position
pSINMEB02:complement(936347..937381)
Genome map
AA seq 344 aa AA seqDB search
MTDLKGALIGCGFFAVNQMHGWRDAEGARIVAICDRDPERLKAVGDAFGIQRRYTSAEDL
FADGGFDFVDIATTVGSHRGLVEMAARHGVATICQKPIAPTMEDAKAMVSACAKSGVAFM
VHENFRWQSPIRAVKAAIDSGAIGEVFWGRVSFRSGYDVFSGQPYLATGKRFIIEDLGIH
ALDVARYIFGDATAVTARTRRVNPAIAGEDVATMLLDHDGGITSLVDCSYATKLPIEPFP
ETLMEVDGSKGTLRLTQGYHLAVHSKGATKLTNVEPPALSWASPPWHNIQESVALIQQHW
IEALRAGREPDTSGRDNLETFALVEASYLSAAEGRTVSLAEVLG
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgactgatctcaaaggcgcgctgatcggctgcgggttcttcgcagtcaaccagatgcat
ggctggcgtgacgcggaaggggcgcgcatcgttgccatctgcgatcgcgatcccgagagg
ctgaaggccgtcggcgacgcgttcggcatccagcggcgctacacctcggccgaggacctt
tttgccgatggcggcttcgatttcgtcgacatcgccacgaccgtcggaagtcaccggggg
ctggtggagatggccgcacgacacggggtcgcgacgatttgccagaagccgatcgcgccc
accatggaggacgccaaggcaatggtctcggcttgcgcgaaatcaggagtggcgttcatg
gttcacgagaatttccgctggcagtcgccgatacgggcggtaaaggcggcgatcgacagc
ggcgcgatcggcgaggtgttctgggggcgggtaagcttccggtcgggctacgacgtcttt
tccggccagccctatctcgccacgggcaagcgcttcatcatcgaggatctcggcattcat
gcgctcgatgtcgcgcgctacatcttcggcgatgcgacggcggtgaccgcgcgcacgcgc
cgggtcaatccggcgatcgccggcgaggacgtcgcaacgatgctcctggaccatgacggg
gggatcacatcgctcgtcgactgcagctacgcgaccaagctgccgatcgagcctttcccc
gagaccctcatggaggtggacgggagcaagggcaccttgcggctgacgcagggctatcac
cttgccgttcactcgaagggcgctacgaaattgacgaacgtggaaccgcccgccctttcc
tgggcgtcgcctccctggcacaacatccaggagagcgtcgcgctcatccagcagcattgg
atcgaagccttgcgtgccggacgcgagccggatacgtccggccgcgacaatctcgagacc
ttcgccctggtggaggcctcctatctgagcgcggcggaaggacggaccgtttcactcgcg
gaggttctcggatga

DBGET integrated database retrieval system