KEGG   Sinorhizobium meliloti BL225C: SinmeB_4323Help
Entry
SinmeB_4323       CDS       T01884                                 

Definition
(GenBank) Monosaccharide-transporting ATPase
  KO
K17204  erythritol transport system ATP-binding protein
Organism
smq  Sinorhizobium meliloti BL225C
Pathway
smq02010  ABC transporters
Module
smq_M00590  Erythritol transport system
Brite
KEGG Orthology (KO) [BR:smq00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SinmeB_4323
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:smq02000]
    SinmeB_4323
Transporters [BR:smq02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Erythritol transporter [MD:M00590] [OT]
    SinmeB_4323
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_23 AAA_29 AAA_13 SMC_N RsgA_GTPase AAA_30 AAA_25 AAA_15 DLIC DUF2813
Motif
Other DBs
NCBI-ProteinID: AEG08606
UniProt: A0A0E0UPQ2
Position
pSINMEB02:complement(938451..939995)
Genome map
AA seq 514 aa AA seqDB search
MHPADDDDCVLRLEDVTKVYSGIIAVRHANLSLRRGAVNVLVGENGAGKSTLMRIIAGVE
KPSLGRILLHGQQVEFHSPADAQRHGIGMVFQELNLFGNLSVAENIFATRELTRGIRGID
HRAQVERATGFLDRLDAGIDAETLVEDLPIGQQQLVEIAKAISLDTRILILDEPTSALSA
AEVDVLFKVIRELKAQGVAIVYISHRLEELMRIGDYITVLRDGQITGHAMVKDIDTKWIV
RSMIGSDAKDFAKSVDHRLGEEAFRAEEICLPRRTGGLAVDHVSISVRAGEVLGIYGLMG
AGRSEFFECVMGQHPHSSGRVFVGGTEVDASDTSGRISAGLALIPEDRQREGLVQALSIA
SNLTLASLDRFVRFGFHIVGAREQASIAAAIRDLSIKAPNPDFEVTSMSGGNQQKVVIGK
ALMTKPKVLLMDEPSRGIDVGAKADVFRTMRRLAGEGLAILFSTSDLEEVMALSDRIAVM
SNGRLVTVIDRADATEEMIIKASAEGHKTTREHA
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgcacccagctgacgacgatgactgcgtcctgcgcctcgaagacgtgacgaaggtctat
tcgggtataattgcggtgcgccatgcgaacctttcgctccggcgcggcgccgtgaatgtg
ctcgtcggggaaaacggtgccggcaagtcgaccctgatgcggatcatcgccggcgtcgag
aagccgtcactcggccgcatcctgctccacggccagcaggtggagttccattcgccggcc
gacgcgcagcgccacggcatcggcatggtcttccaggagctcaatctgttcggcaatctc
tcggttgccgagaacatcttcgcgacgcgggagctgacccggggcattcgcggcatcgat
catcgcgcgcaggtcgagagggctaccgggttcctcgacaggctcgatgccgggatcgat
gccgagacgctcgtcgaagacctgccgatcggccagcagcagctggtggagatcgccaag
gcgatctcgctcgatacccgcatccttattctggacgagccgacatcggccctttcggcg
gcggaggtggacgtccttttcaaggtcatccgggagctgaaggcgcaaggggtggcgatc
gtctacatttctcaccggctcgaggagctgatgcggatcggcgactacatcaccgtgctc
agggatggacagatcaccggccacgccatggtcaaggacatcgataccaagtggatcgtc
cggtcgatgatcggctcggatgcgaaggacttcgccaaatcggtcgaccaccgcctcgga
gaggaggcgttccgcgccgaggagatctgcctgccgcgccggaccggcgggctcgcggtc
gatcatgtctcgatctcggtacgtgccggcgaggtgttgggcatctacgggctgatgggg
gccggccgaagcgaattcttcgaatgcgtcatgggccagcacccgcattcctcggggcgg
gtcttcgtcggcgggacggaggtcgacgccagcgacacgtcgggcaggatcagcgcagga
ttggcgctcataccggaagatcgccagcgcgagggtctcgtccaggcgctttcgatcgcc
agcaacctgacgcttgcgagcctcgaccgcttcgtccgcttcggcttccatattgtcggc
gcgcgggagcaagcctcgatcgcggcggccatccgcgatctttccatcaaggcgcccaac
ccggacttcgaggtgacctcgatgtccggcggcaaccagcagaaggtcgtcatcggcaag
gccctgatgacgaaaccgaaggtgctgctgatggacgaacccagccgcggaatagatgtc
ggcgccaaggcggatgtcttccgcaccatgcgccggcttgccggcgaggggctcgccatc
ctcttttccacctccgacctcgaagaggtcatggcgctctccgaccgcatcgccgtcatg
agcaacggacggctggtcacggtcatcgaccgcgcggacgcgacggaagagatgatcata
aaggcttcggccgagggtcataaaacgacaagggaacacgcctga

DBGET integrated database retrieval system