KEGG   Sinorhizobium meliloti BL225C: SinmeB_4330Help
Entry
SinmeB_4330       CDS       T01884                                 

Definition
(GenBank) transcriptional regulator, AraC family
Organism
smq  Sinorhizobium meliloti BL225C
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AraC_N HTH_18 HTH_AraC AraC_binding HTH_5 TetR_N AraC_binding_2 P63C
Motif
Other DBs
NCBI-ProteinID: AEG08613
UniProt: A0A0E0UQ83
Position
pSINMEB02:948003..948959
Genome map
AA seq 318 aa AA seqDB search
MSTIMFPQKDLREETAALRAQILDRLSKLPWDGLSFAHPVPGLSLYRIVEPAGPFSSVYE
PSLSFIIKGSKNVRVGNETLVYDEGCFFLTAVGVPVTAQICAASEGEPYVAAALRLDMEK
VRRIIADHDIHPTDIPERDLGVAVGTATRELFDALFRLISLASSPADIPFLAGHIQNEIL
YRLLTGEQGARLRRFALAGTNSNRVAKAVLWLKENYTKPLRVEELAEIANMGVSTLHHHF
RAMTAMSPLQFQKHLRLHHARELMLSKSLDAATAALQVGYESPTQFNREYRRAFGHPPLR
DIRAILNSNDSTRRNSAG
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgatcatgttcccgcagaaggacttgcgcgaagagacggcagccctgcgcgcg
cagattctcgacaggctgtcgaaattgccctgggacgggctttccttcgcgcatcccgtt
ccaggcctctcgctctatcgcatcgtcgagccggcgggccccttttcgagcgtatacgag
ccgagcctctccttcatcatcaagggcagcaagaatgtccgcgtcggcaacgagacgctc
gtctacgatgaaggctgcttcttcctgaccgccgtcggggttcccgtaactgcgcagatc
tgcgcagcgagcgaaggggagccctatgtcgcagccgccttgcggctggacatggaaaaa
gtgcggcgcatcattgctgatcacgacatacacccgaccgacattcccgaacgcgacctt
ggtgtggctgtcggtaccgcgacgcgcgagctcttcgacgccctgttccggctgatttcg
cttgcgagctcgccggccgacattccgttcctggccggccatatccagaacgagatcctc
tatcggcttctcaccggcgagcagggcgctcggctgcggcgcttcgcgctcgcgggcacg
aacagcaaccgcgtcgccaaggcggttctatggttgaaggaaaactacaccaaaccgctt
cgcgtggaagaactcgccgagatcgccaatatgggcgtctccacgctgcaccatcacttc
cgtgcgatgaccgcaatgagcccgctgcagttccagaagcatctgcgactgcatcacgca
cgggaactgatgctttccaagtcgctcgatgcggcgacggcggcgctgcaggtcggctac
gagagcccgactcagttcaaccgggagtatcgccgggcattcggccatccgccgctgcgc
gacatccgggcgattctgaattccaacgattcgaccaggcggaactccgcaggctga

DBGET integrated database retrieval system