KEGG   Sinorhizobium meliloti BL225C: SinmeB_4332Help
Entry
SinmeB_4332       CDS       T01884                                 

Definition
(GenBank) Aldehyde dehydrogenase (pyrroloquinoline-quinone)
  KO
K07303  isoquinoline 1-oxidoreductase subunit beta [EC:1.3.99.16]
Organism
smq  Sinorhizobium meliloti BL225C
Brite
Enzymes [BR:smq01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.99  With unknown physiological acceptors
    1.3.99.16  isoquinoline 1-oxidoreductase
     SinmeB_4332
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C TAT_signal
Motif
Other DBs
NCBI-ProteinID: AEG08615
UniProt: A0A0E0UQL6
Position
pSINMEB02:949696..951909
Genome map
AA seq 737 aa AA seqDB search
MIPKLMQSITLPVARAEASRRQFLLGALAAGTGVAIGYRILSASPALAGEAATESGSHAF
SPYLTIGGDGKVTVLSSQFEMGQGSYNGIATLVAEELDADWSAIDVIGAAGNIKAYGNIA
FGGTMQGTGGSTSMSTSWERYRRAGAAARAMLVAAAAAEWGVDAAEIAVENGVLSHPSGK
SGGFGAFAAKAATMPVPADVKLKEPGDWKLIGNAELKRFDSARKANGTEQYTIDVKLPGM
LTAVMIHPPLFGAKAKSFDASAARAIKGVVDVVETPRGIAVVGEHMWAAIKGREAVTVEW
DETGAEKRGTPELMSTYRDLAGKTPAAFARKDGDTDAAFTSAAKVIEATFEFPYLAHAAL
EPLNAVARRNDDGTIEIWGGHQLPDVYQNLASEIAGVPVEKVRLNVMKTGGSFGRRAVFD
GDVVVEAVHVAKALGFRAPVKVQWTREEDTRAGRYRPAYVHRLKAGIDEAGKLVAWSDHI
VGQSIMAKTAWDGMVQNGVDPTSVEGANNLPYAIANQTVGLTTTDVRVPVLWWRSVGSTH
TAFAAEAFLDEVAEAAGRDPLEFRLSMLKPDSRHATVLKLAAEKAEWQKPLPKGRFRGVA
VAESFGSVVAQIAEVSVDGDGIKVERVVAAVDCGLAINPDQVRAQVEGGIGFGLSAILGE
EITLTDGKVDQGNFDMYTPLRIDAMPKVEVHIVASANPPSGIGEPGVPPIGPAVANAAFK
ALGKRIRVMPFAKSLNA
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgataccgaaactgatgcaatcgatcacccttcccgtcgcccgggccgaagcgtcgcgg
cggcaattcctgctcggtgcgcttgcggccggcaccggcgtcgcaatcgggtaccggatc
ctgtccgcatcgccggcactggcgggcgaggcggcaacggagagcggctcacacgcattt
tccccatacctgaccatcggcggggacggaaaggtcaccgtcctctcgtctcagttcgag
atgggccagggctcctataacggcattgccacgctggtggcggaggaactcgacgcggat
tggtccgcgatcgacgtcatcggagccgccggcaatatcaaggcttacggcaatatcgcc
ttcggcggcacgatgcagggcacgggagggtcgacctccatgtccacctcctgggagcgc
tatcgcagggcaggtgccgccgcccgggcgatgctggttgctgccgctgcagcggaatgg
ggcgtcgacgcggccgagatcgcggtcgagaacggcgttctttcgcatccatccggcaag
agcggcggtttcggcgcgtttgcagccaaggcggctaccatgccggtgccggccgacgtg
aagctcaaggagccgggagactggaaacttatcggcaatgccgaactgaagcgcttcgac
agtgcccgaaaggcaaacggaaccgagcaatacaccatcgacgtcaagctccccggaatg
ctgacagcggtgatgatccacccgcctctcttcggcgcgaaggcgaagtccttcgatgct
tccgccgcgcgtgcgatcaagggcgtggtcgacgtggtggaaacgccccgcggcatcgcc
gtggtcggcgagcatatgtgggccgcgatcaaaggccgcgaggcagtcacggttgagtgg
gacgagacgggcgccgaaaagcgcggaacgcccgagctgatgtccacctatcgcgatctt
gccggcaagacgccggccgcattcgcgcgcaaggacggggataccgacgccgcattcaca
tcggcggcaaaagtcatcgaagcgacgttcgagttcccctatctcgcgcatgctgccctg
gaacccctgaacgcggtcgcgcgcaggaacgacgacggcacgatcgagatctggggcggg
caccagctccccgacgtgtaccagaacctcgccagcgagattgccggagtgccggtcgaa
aaggtccggctcaacgtcatgaagaccggcggcagcttcgggcggcgtgcggtattcgac
ggcgatgtcgtggtagaggctgtccatgtggcgaaggccctcggtttccgtgcaccggtc
aaggtgcagtggacgcgggaggaagacacccgcgcgggccggtatcgtccggcctatgtg
catcggctgaaggccgggatcgacgaagccgggaagctcgtcgcctggagcgatcacatc
gtcggccagtcgatcatggcgaaaacggcctgggacggcatggtccagaacggggtcgac
ccgacctcggtggagggcgccaacaacctcccctatgccattgcgaatcagaccgtcggc
ctcacgaccaccgacgtccgcgtcccggttctctggtggcgctccgtcggctcgacacac
accgcattcgcagccgaagcttttctggacgaggttgccgaggctgcgggacgggatccg
ctcgagttccgactgtcgatgctgaagccggactcgcgccatgcgaccgttctcaagctc
gcagcggagaaggccgaatggcagaagccgttgcccaaaggccgcttccggggcgtcgcc
gtcgccgagagcttcggttcggttgtggcacagatcgccgaggtctccgtcgatggcgac
ggtatcaaggtcgagcgcgtcgtggctgccgtcgattgtggtctcgcgatcaatccggat
caggtccgcgctcaggtcgagggcggtatcggcttcgggctgagcgccatcctgggtgag
gaaatcacgctgaccgacggcaaggtcgatcaggggaacttcgacatgtacacaccactc
aggatcgatgcgatgccgaaggtggaggttcatatcgtcgcctccgccaatccgccttcg
gggatcggcgagcccggcgttccgccgatcggccctgcggttgccaatgccgccttcaag
gcgctcggcaagcggatccgcgtcatgcccttcgcgaaatcgctcaacgcctga

DBGET integrated database retrieval system