KEGG   Sinorhizobium meliloti BL225C: SinmeB_4339Help
Entry
SinmeB_4339       CDS       T01884                                 

Definition
(GenBank) hypothetical protein
Organism
smq  Sinorhizobium meliloti BL225C
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AEG08622
UniProt: A0A0E0UPN4
Position
pSINMEB02:complement(955491..956282)
Genome map
AA seq 263 aa AA seqDB search
MTSWLVRNLAFAASCLLGSSALAADIYSPMTPQAREITTESGWTFSFAPYFWAAGLSGDI
GQFGLSAVDVDASFSDVFDHLDFALMATAEARNGPYSIFGDAIYIKLSGQGATPRGFLAD
DVELATETFAGLLGAGYAIYDDGSSRLDIVGGLRVWSVESELSISGGALGTRSRTDDAAW
VDGMAGFRGTYSITPEIYLTGWGLVGAGGADLDWDVAAAIGYRFSDTVSAVAGYRALGVD
YSDDGFVFDVVEQGPILGLVVRF
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcttggctcgttcgaaatctggcatttgccgcaagctgcctgctcggaagcagc
gccttggcggcggacatatattcgccgatgacgccgcaggcgcgggaaatcacgacggag
agcggctggacgttttccttcgccccctatttctgggccgctggcctttcgggcgatatc
ggccagttcggtctgtccgccgtcgatgtggacgcgagtttcagcgacgtcttcgaccat
ctggatttcgctttgatggccacggcggaggcacgcaacggaccgtacagcatcttcggt
gacgcgatatacatcaaactgtcgggtcagggcgcgacgccgaggggtttccttgcggac
gatgtcgagcttgcgaccgaaacattcgcgggactgcttggggccggttacgcgatttac
gatgatggctcctctcggctcgacattgtcggcggcctgcgcgtgtggtccgtcgagagc
gagctctccatcagcggtggcgctctcggtacacggtcgagaaccgacgatgcggcctgg
gtggacgggatggcaggttttcgcggcacctactcgatcactccggaaatctatctgacc
ggatgggggcttgtcggggccggtggcgcggatctcgactgggacgtcgccgcagcgatc
ggctaccggttcagcgacacggtttcggcggtcgccggctaccgcgcgcttggcgtcgac
tacagcgatgacggctttgtcttcgacgtggtcgagcagggaccgatcctggggctggtg
gtgcgcttctaa

DBGET integrated database retrieval system