KEGG   Sinorhizobium meliloti BL225C: SinmeB_4340Help
Entry
SinmeB_4340       CDS       T01884                                 

Definition
(GenBank) protein of unknown function DUF900 hydrolase family protein
Organism
smq  Sinorhizobium meliloti BL225C
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF900 Abhydrolase_6 LIDHydrolase PGAP1 Hydrolase_4 RnfC_N
Motif
Other DBs
NCBI-ProteinID: AEG08623
UniProt: A0A0E0UQ92
Position
pSINMEB02:complement(956332..957600)
Genome map
AA seq 422 aa AA seqDB search
MSDVSSRGDGFRVAKAGGSALSALLALALLAGCGGHPKGVMTPVALAQPSNTSQVDMLVA
TTRQPSGDPATLFSGERSPTLSMTDVAVSIPPDSRRAPGTVQWPRKLPPNPETDFAVTRV
REMASEDEARTWFRAHNKDGHVLLFVHGFNNRYEDGVFRLAQIVHDSGAQATPMLFTWPS
RARVFDYNYDKESTNYSRTALEDTLRTLANAPNVKDVTILAHSMGTWLTMEALRQMGIRD
GKIAPKIENVILASPDIDLDVFAKQWTDMGDERPKFTIFVSQDDRALALSRLISGDVSRL
GAIDPSAEPYRTQLETAGITAIDLTKVETDDGLHHGKFAESPEIVQLIGQRIIKGQTLTD
SEITLGEGITAVVAGTAKNVGTVAAATITAPVTIIEGRGTPPKQVRLNETLASDERSQRA
VP
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
ttgagtgacgtaagttcgcgcggcgacgggttccgtgtagccaaggccgggggatcggcc
ttatcggcgcttctcgcgctcgctctgttggcgggttgcgggggtcaccctaaaggcgtc
atgactccggtggctctggcgcagccgtcgaacacctcgcaggtcgacatgctggtagcg
accacgcgccagccctcgggcgacccggcgaccctgttttcgggagagcgcagcccgacg
ctttcgatgaccgatgtggcggtttcgatcccgccggactcgcgccgcgcgccgggcacg
gtgcagtggccgcgcaagctgccacccaatccggaaaccgatttcgccgtcacgcgcgtg
cgcgaaatggcatcggaagacgaggcgcgcacctggttccgcgcccataacaaggacggc
catgtgcttcttttcgtgcatggcttcaacaaccgctatgaggacggcgtcttccggctg
gcccagattgtccatgattccggtgcgcaggcgacacctatgctgttcacctggccgtcg
cgtgcgcgggtgttcgactataattacgacaaggagagcaccaactattcgcgcaccgcg
ctcgaggatacgctgcgcacgctggcaaatgccccgaacgtcaaggacgtcaccatcctt
gcccattctatgggaacctggctgacgatggaggcgctgcgccagatgggaattcgcgac
gggaagatcgcgccgaagatcgagaacgtgattctcgcttcgcccgacatcgacctcgac
gtcttcgccaagcagtggaccgatatgggcgatgaacggccgaaatttacgatcttcgtc
tcgcaggacgaccgggcgctggcgctttcgcgactgatctcgggggatgtctcgcggctc
ggcgcgatcgaccccagcgccgaaccctatcgcacgcagctagagacagccggcattact
gcgatcgacctcaccaaggtcgagacggatgacggcttgcaccacggcaagttcgctgag
agccccgagatcgtgcaactgatcgggcagcggatcatcaaggggcagacgctgaccgac
tccgagatcactttgggcgaagggatcaccgccgtcgtcgccggcacggccaagaatgtc
ggcaccgtcgcggctgccacgatcaccgcgccggtcaccataatcgaaggccgcggcacg
ccgccgaagcaagtccggctgaacgaaaccctcgccagtgacgaacgctctcaacgtgca
gtgccatag

DBGET integrated database retrieval system