KEGG   Sinorhizobium meliloti BL225C: SinmeB_4348Help
Entry
SinmeB_4348       CDS       T01884                                 

Definition
(GenBank) Glycerol-3-phosphate-transporting ATPase
  KO
K10111  multiple sugar transport system ATP-binding protein [EC:3.6.3.-]
Organism
smq  Sinorhizobium meliloti BL225C
Pathway
smq02010  ABC transporters
Module
smq_M00200  Putative sorbitol/mannitol transport system
smq_M00204  Trehalose/maltose transport system
smq_M00207  Putative multiple sugar transport system
Brite
KEGG Orthology (KO) [BR:smq00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SinmeB_4348
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:smq02000]
    SinmeB_4348
Enzymes [BR:smq01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.-  
     SinmeB_4348
Transporters [BR:smq02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Maltose/maltodextrin transporter [MD:M00194] [OT]
    SinmeB_4348
   Arabinogalactan oligomer/maltooligosaccharide transport system [MD:M00491] [OT]
    SinmeB_4348
   Trehalose/maltose transporter [MD:M00204] [OT]
    SinmeB_4348
   Putative sorbitol/mannitol transporter [MD:M00200] [OT]
    SinmeB_4348
   Putative multiple sugar transporter [MD:M00207]
    SinmeB_4348
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran TOBE_2 AAA_21 TOBE RsgA_GTPase AAA_29 AAA_16 AAA_22 AAA_33 AAA_23 AAA_15 Rad17 AAA AAA_28 AAA_30 AAA_18 MMR_HSR1 NB-ARC gpW ATPase_2 NACHT AAA_25 AAA_5 RNA_helicase
Motif
Other DBs
NCBI-ProteinID: AEG08630
UniProt: A0A0E0UQN1
Position
pSINMEB02:complement(965910..966938)
Genome map
AA seq 342 aa AA seqDB search
MAELQLRDIRKSFGAFDVIKGVSMEIKPGEFMVFVGPSGCGKSTLLRLIAGLEEITSGTL
AFDGQIVNQLTPSRRGIAMVFQSYALYPHMTVYENMAFGMQLAGKDKQQCRKRVEAAAEM
LQLTPYLERLPRQLSGGQRQRVAIGRAIVRDPKVFLFDEPLSNLDAALRVATRLEIAKLH
RSMHKTTMIYVTHDQVEAMTLADRICVLRDGLVEQIGTPLELYETPNSVFVAGFIGSPKM
NFLSGAFAEPYKADTIGIRAEHLEIDEQGGEWSGTVIHSEMLGSDSYIYLDIGTGEPVIV
RESGIAKQQPGQTIRISPADGQVHRFDAGGRALGRMQMRGAA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggcagagcttcaattgcgcgatatccgcaaatccttcggcgccttcgatgtgatcaag
ggcgtcagcatggaaatcaagccgggcgagttcatggtcttcgtcggcccttccggctgc
ggcaagtcgaccctcctgagactgatcgccgggctcgaggaaatcacctccggaacactt
gccttcgacggccagatcgtcaatcagctgacgccttcgcgccgcggcatcgccatggtc
tttcagtcctatgcgctctatccgcatatgacagtctacgagaacatggccttcggcatg
cagcttgcaggcaaggacaagcagcagtgccgcaagcgggtcgaggcggcggccgaaatg
ctgcagctcacgccctatctcgaacgcctgccgcgccagctttcgggcgggcagcgccag
cgcgtggcgatcggccgggcgatcgttcgcgatcccaaggtctttctgttcgacgagccg
ctttcgaacctcgacgcggcgctgcgtgtggccacgcgcctcgaaatcgccaagcttcac
cgcagcatgcacaagacgacgatgatttatgtgactcacgatcaggttgaggcgatgacg
ctcgccgacaggatatgcgttctgagggacggtctcgtcgagcagatcggcacgccgctg
gagctttacgagacgccgaattcggtgttcgtcgcgggcttcatcggttcgccgaagatg
aatttcctttccggcgccttcgcagagccatacaaggcggacacgatcggcatccgcgcg
gaacacctggagatcgatgaacagggaggtgagtggagtgggaccgtgatccattcggag
atgctcggttccgacagctatatttatctcgacatcgggaccggcgagccggtgatcgtc
cgcgagagcggcatcgccaagcagcagcccgggcagacgatcaggatctcgccggccgac
ggccaggttcaccgcttcgatgcgggtggccgggcgctcggacggatgcaaatgcggggt
gcggcctag

DBGET integrated database retrieval system