KEGG   Sinorhizobium meliloti BL225C: SinmeB_4350Help
Entry
SinmeB_4350       CDS       T01884                                 

Definition
(GenBank) ABC-type transporter, integral membrane subunit
  KO
K10237  trehalose/maltose transport system permease protein
Organism
smq  Sinorhizobium meliloti BL225C
Pathway
smq02010  ABC transporters
Module
smq_M00204  Trehalose/maltose transport system
Brite
KEGG Orthology (KO) [BR:smq00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    SinmeB_4350
Transporters [BR:smq02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Trehalose/maltose transporter [MD:M00204] [OT]
    SinmeB_4350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: AEG08632
UniProt: A0A0E0UPP4
Position
pSINMEB02:complement(967778..968764)
Genome map
AA seq 328 aa AA seqDB search
MTDLSLADRPAALAHGGRIGSDLQAQRVRSAWLFLAPTFLVLALVAGWPLIRTIYFSFTN
ASLTNLSGAEFVGFANYLSWITLKSGRTIYRGLLADPAWWNAVWNTLKFTVLSVSIETAL
GLIVALVLNAQFPGRGLVRAAILIPWAIPTIVSAKMWAWMLNDQFGILNDMLIGLGLIGE
KIAWTASPDTAMIAVLIVDVWKTTPFMALLILAGLQMVPGDIYEAAKIDGVHPVRVFWRV
TLPLIRPALMVAVIFRMLDALRIFDLIYVLTPNNAQTKTMSVMARENLFDFDKFAYGAAA
STMLFLIIATITILYMWLGRLNLSGGER
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgactgatctctccctcgcggatcggccggctgcgcttgcgcatggcggcaggataggc
tcggacctgcaggcgcaacgggtccgttcggcctggctctttctcgcgccaaccttcctc
gtcctggcgctcgtcgccggctggccgctcatccgaaccatctatttcagtttcaccaac
gcctcgctgaccaatctatcgggcgccgaattcgtcggcttcgccaattatctctcatgg
atcaccctgaagagcgggcggacgatttacaggggcctgcttgcggaccccgcctggtgg
aatgcggtctggaacacgctcaaattcacggttctttcggttagtatcgaaacggcgctg
ggccttatcgtcgctttggtactcaacgcgcagtttcccggtcgcggacttgtccgtgcc
gcgatcctgatcccctgggcgatcccgaccatcgtctccgcgaaaatgtgggcctggatg
ctcaacgaccagttcggcatcctcaacgacatgctcatcggcctcggcctgatcggcgag
aagatcgcctggaccgccagccccgacaccgccatgatcgccgtattgatcgtcgacgtc
tggaagacgacgcccttcatggcgctcctgatcctcgccgggctgcaaatggtgccgggc
gatatttacgaagccgccaaaatcgacggcgtccatccggtacgtgtcttttggcgggtc
accctgccgctgatccggccggcgctgatggtcgcggtcatcttccgcatgctcgacgcg
ctgcgcattttcgacctcatctacgttctgacgcccaacaacgcacagaccaagacgatg
tcggtcatggcgcgcgaaaaccttttcgatttcgacaagttcgcctatggcgcggccgcc
tccaccatgctgttcctgatcatcgcgacgatcacgatcctctacatgtggctcggtcgt
ctcaacttgagcggaggagaacgctga

DBGET integrated database retrieval system