KEGG   Sinorhizobium meliloti BL225C: SinmeB_4351Help
Entry
SinmeB_4351       CDS       T01884                                 

Definition
(GenBank) extracellular solute-binding protein family 1
  KO
K10236  trehalose/maltose transport system substrate-binding protein
Organism
smq  Sinorhizobium meliloti BL225C
Pathway
smq02010  ABC transporters
Module
smq_M00204  Trehalose/maltose transport system
Brite
KEGG Orthology (KO) [BR:smq00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SinmeB_4351
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:smq02000]
    SinmeB_4351
Transporters [BR:smq02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Trehalose/maltose transporter [MD:M00204] [OT]
    SinmeB_4351
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_1 SBP_bac_8 SBP_bac_11 SBP_bac_6 Glyco_transf_29
Motif
Other DBs
NCBI-ProteinID: AEG08633
UniProt: A0A0E0UQA0
Position
pSINMEB02:complement(968852..970123)
Genome map
AA seq 423 aa AA seqDB search
MNVKPFVRTLISCAAIVGAIDLAAAAELSMAANSTGKNLSFLRDQIARFEKETGHKVNLV
TMPASSSEQFSQYRLWLAAGNKDVDVYQTDVIWAPQLAEQFVDLTEATKDVVGEHFPSII
QSQTVNGKLVALPFYTDAPALYYRKDLLDKYGKTPPKTWDELAATAKEVQDKERAAGSAD
IWGFVFQGNAYEGLTCNALEWIKSSGGGQIIEPDGTISVNNEKAAAAVEKVKEWIGTIAP
KGVLAYQEEESRGVWQTGNAVFMRNWPYAYALGNGDDSAVKGKFEVAPLPAATDGDQPSS
TLGGWNLAVSKYSEEQEAAIAFVKFLGSAETQKVRAIELSNLPTIAALYDDPEVAAAQPF
MPHWKPIFQSAVPRPSAVAKVKYNEVSSKFWSAVHNTLSGNGTAAENLELLEVELTELKG
DAW
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtgaagccttttgtaaggacgctgatttcctgcgccgcgatcgtcggcgcgatc
gaccttgctgccgccgccgaattgtctatggcggccaattcgaccggcaagaatctgagt
tttctgcgggaccagatcgccaggttcgagaaggagacgggtcacaaggtcaacctggtg
accatgccggcttcgagcagcgagcagttcagccagtatcgactctggcttgccgccggg
aacaaggatgtcgatgtctaccagacggacgtcatctgggctccgcagctcgccgagcag
ttcgtcgacctgaccgaggcgacgaaggacgtggtcggcgagcacttcccttcgatcatc
cagtcgcagacggtcaacggcaagctggtcgctctgcccttctacaccgacgcgccggcg
ctttattaccgcaaggacctgctcgacaaatacggcaagacgccacccaagacctgggat
gaactggcggcgacggcgaaggaggttcaggacaaggagcgtgccgccggcagtgccgat
atctggggcttcgtctttcagggcaatgcctatgaggggctcacctgcaacgcgctcgag
tggatcaagtcgtccggcggcggtcagatcatcgagcccgacggcacgatctccgtcaac
aacgaaaaggcggcggcggccgtcgagaaagtcaaggaatggatcggcacgatcgcgccc
aagggcgtgcttgcctatcaggaggaggaatcacgcggcgtctggcagaccggcaacgcc
gttttcatgcgtaactggccctatgcctacgcccttggcaacggggacgacagcgccgta
aagggcaaattcgaagtggccccgcttccggccgccaccgacggcgatcagccgtcctcg
acactcggcggatggaacctcgcggtctcgaaatattccgaagagcaggaggcggcgatc
gccttcgtcaagttcctgggctcggccgaaacccagaaggtgcgtgcgatcgagctttcg
aaccttccgacgatcgcggcgctttacgacgatccggaagtcgcggcggcccagccgttc
atgccgcattggaagcctatcttccagagcgccgtgccgcgcccctcggccgtggcaaag
gtgaagtacaacgaagtgtcctccaagttctggagcgccgtgcacaacacgctttcgggt
aacggaacggcggcggagaatctcgagcttctcgaagtcgaactgaccgaactcaagggc
gacgcttggtaa

DBGET integrated database retrieval system