KEGG   Sinorhizobium meliloti BL225C: SinmeB_4362Help
Entry
SinmeB_4362       CDS       T01884                                 

Definition
(GenBank) Glycerone kinase
  KO
K05878  phosphoenolpyruvate---glycerone phosphotransferase subunit DhaK [EC:2.7.1.121]
Organism
smq  Sinorhizobium meliloti BL225C
Pathway
smq00561  Glycerolipid metabolism
smq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    SinmeB_4362
Enzymes [BR:smq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.121  phosphoenolpyruvate---glycerone phosphotransferase
     SinmeB_4362
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dak1
Motif
Other DBs
NCBI-ProteinID: AEG08644
UniProt: A0A0E0UPX7
Position
pSINMEB02:981851..982843
Genome map
AA seq 330 aa AA seqDB search
MQRFINNPDEVVEDTVKGFVKAHADIVRLGENPRVIVARGAPVAGKVGVVTGGGSGHEPA
FIGYTGRNMLDAVAVGELFSSPTAKSFHDAMREADGGKGVVCLYGNYAGDNMNVKMAVKL
AAKAGIEVATVVANDDVCSAPPEEREKRRGVAGEIFMWKIGGAKAAAGASLEEVRAAAQK
AIDNCRSIGVGLGPCTLPAVGHPNFRIEPGTMEVGIGHHGEPGLRVEALKTAEEVAVDMC
KIVLDDHDLPQGTEVAVLVSGLGATPLNELYILNDTIEREITARGLKIYRTFVGNYFTSL
EMVGATLTVMALDEELKALLDVEVRCTAVL
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgtttcatcaacaatcccgacgaagtcgtcgaggataccgtcaagggtttcgtc
aaggcgcatgccgacatcgtccgcctcggcgaaaatccgcgcgtcatcgtcgcaaggggc
gcgccggttgccggcaaggtgggtgtcgtgaccggcggcggctccggccatgagcctgcc
ttcatcggctacaccggccgcaacatgctggacgcggtcgccgtcggcgagctcttttcc
tccccgacggccaagagctttcacgacgcgatgcgcgaggcagacggcggtaagggcgtc
gtctgcctctacggcaactatgccggcgacaacatgaacgtgaagatggcggtgaagctc
gcggccaaggcagggatcgaagttgcgacggtcgtggccaatgacgacgtctgctccgcg
ccgcccgaagagcgcgagaagcggcgcggcgtcgccggagaaatcttcatgtggaagatc
ggcggggccaaggcggccgccggcgcgagtctcgaagaggtccgtgcggctgcccagaag
gcgatcgacaattgccgctcgatcggggtcgggctcggcccctgcaccctccccgcggtc
gggcatccaaacttccggatcgagccgggcacgatggaagtcggtatcggccatcacggt
gagcccggcctgcgcgtcgaagcgctgaagaccgccgaagaggtcgctgtcgacatgtgc
aagatcgtgctggacgatcacgacctgccgcagggcacggaagtggctgtgctcgtctcc
ggcctcggcgcaacgccgctcaacgaactctacatcctgaacgacacgatcgagcgcgag
atcaccgcccggggcctcaagatctaccgcaccttcgtcggcaactacttcacttcgctc
gaaatggtcggagcgacgctgacggtcatggcgctcgacgaagaactcaaggcgctcctc
gatgtcgaggtccgctgcaccgccgttctctga

DBGET integrated database retrieval system